(data stored in SCRATCH zone)

EMBL: CP000880.PE168

CP000880.PE168       Location/Qualifiers
FT   CDS             complement(161672..162199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0333 7.1e-12 rhodanese-related
FT                   sulfurtransferase; COG: COG0607 Rhodanese-related
FT                   sulfurtransferase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20122"
FT                   /db_xref="GOA:A9MG14"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG14"
FT                   /inference="protein motif:HMMPfam:IPR001763"
FT                   /inference="protein motif:HMMSmart:IPR001763"
FT                   /inference="similar to AA sequence:INSD:CAD05907.1"
FT                   /protein_id="ABX20122.1"
FT                   /translation="MSIGIVSPREAQALIAQGAKLIDVRDADEYLREHIPHAQLAPLSQ
FT                   LEQGALPANLRAEQIIFHCQSGKRTSSNAAKLQAVAAPAQVSLLEGGIDGWKAAGLPVT
FT                   EDKSQPLPLMRQVQIAAGGLTLLGVILGYTIHGGFFLISGFVGAGLMLAGLTGFCGMAR
FT                   LLEKMPWNTRTH"
     MSIGIVSPRE AQALIAQGAK LIDVRDADEY LREHIPHAQL APLSQLEQGA LPANLRAEQI        60
     IFHCQSGKRT SSNAAKLQAV AAPAQVSLLE GGIDGWKAAG LPVTEDKSQP LPLMRQVQIA       120
     AGGLTLLGVI LGYTIHGGFF LISGFVGAGL MLAGLTGFCG MARLLEKMPW NTRTH            175
//

If you have problems or comments...

PBIL Back to PBIL home page