(data stored in SCRATCH zone)

EMBL: CP000880.PE191

CP000880.PE191       Location/Qualifiers
FT   CDS             182301..182456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20145"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG37"
FT                   /protein_id="ABX20145.1"
FT                   /translation="MQYKGMLRNSRAIIIAAGPDIDRQFSVCKAPDEYHQAFCISAPGH
FT                   SWSYIE"
     MQYKGMLRNS RAIIIAAGPD IDRQFSVCKA PDEYHQAFCI SAPGHSWSYI E                 51
//

If you have problems or comments...

PBIL Back to PBIL home page