(data stored in SCRATCH zone)

EMBL: CP000880.PE196

CP000880.PE196       Location/Qualifiers
FT   CDS             187249..187458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20149"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG42"
FT                   /protein_id="ABX20149.1"
FT                   /translation="MPEVENVNLASGGELAAKARGSLHRDGISGWAQSHYRYSISLIFW
FT                   SVSIAKRLLQEQPLAGFLLRKSCR"
     MPEVENVNLA SGGELAAKAR GSLHRDGISG WAQSHYRYSI SLIFWSVSIA KRLLQEQPLA        60
     GFLLRKSCR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page