(data stored in SCRATCH zone)

EMBL: CP000880.PE20

CP000880.PE20        Location/Qualifiers
FT   CDS             complement(25575..26621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2936 9.2e-177 iap; aminopeptidase
FT                   K01269; COG: COG2234 Predicted aminopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19974"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF22"
FT                   /inference="protein motif:HMMPfam:IPR007484"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461857.1"
FT                   /protein_id="ABX19974.1"
FT                   /translation="MFSATRRFTVILALGVGFIFPAQAASPGPGEIANIQARHIATFFP
FT                   GRMTGSPAEMLTADYLRQQFARMGYQSDIRTFNSRFIYTTRDNRKNWHNVTGSMVIAAH
FT                   EGHVPQQIIIMAHLDTYAPQSDADIDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPT
FT                   HYGIRFIATSGEEEGKLGAENLLKRMSDTEKKNTLLIINLDNLIVGDKLYFNSGKNTPE
FT                   AVRTLTRERALAIARHYGIAASTNPGLNPAYPKGTGCCNDAEVFDKAGLSVLSVEATNW
FT                   NLGKKDGYQQRAKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKE
FT                   LAKAEKTP"
     MFSATRRFTV ILALGVGFIF PAQAASPGPG EIANIQARHI ATFFPGRMTG SPAEMLTADY        60
     LRQQFARMGY QSDIRTFNSR FIYTTRDNRK NWHNVTGSMV IAAHEGHVPQ QIIIMAHLDT       120
     YAPQSDADID ANLGGLTLQG MDDNAAGLGV MLELAARLKD IPTHYGIRFI ATSGEEEGKL       180
     GAENLLKRMS DTEKKNTLLI INLDNLIVGD KLYFNSGKNT PEAVRTLTRE RALAIARHYG       240
     IAASTNPGLN PAYPKGTGCC NDAEVFDKAG LSVLSVEATN WNLGKKDGYQ QRAKNASFPN       300
     GNSWHDVRLD NQQHIDKALP GRIERRSRDV VRIMLPLVKE LAKAEKTP                    348
//

If you have problems or comments...

PBIL Back to PBIL home page