(data stored in SCRATCH zone)

EMBL: CP000880.PE200

CP000880.PE200       Location/Qualifiers
FT   CDS             192982..193251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00207"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1961 Site-specific recombinases, DNA
FT                   invertase Pin homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20154"
FT                   /db_xref="GOA:A9MG46"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A9MG46"
FT                   /inference="protein motif:HMMPfam:IPR006119"
FT                   /inference="similar to AA sequence:REFSEQ:YP_407274.1"
FT                   /protein_id="ABX20154.1"
FT                   /translation="MLIGYVSVSTNDQNTDLQRNTLNCAECELIFEDKISGTKPDRLGL
FT                   KKLFRTLSAGDTLVVWTLENWGAACGILSYWLKNCVSVVLIFAA"
     MLIGYVSVST NDQNTDLQRN TLNCAECELI FEDKISGTKP DRLGLKKLFR TLSAGDTLVV        60
     WTLENWGAAC GILSYWLKNC VSVVLIFAA                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page