(data stored in SCRATCH zone)

EMBL: CP000880.PE206

CP000880.PE206       Location/Qualifiers
FT   CDS             198452..199297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20160"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGP9"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311541.1"
FT                   /protein_id="ABX20160.1"
FT                   /translation="MNNWSPEHTKDIKSWFKIDTYRKFEDLSLIQFYHEIWARNLFFKE
FT                   YREEFESRTLMGYFSKIFSGNPFLIEEGQLGYMTPANKLFQPPHFFLTTLDRLAETSII
FT                   AMQRGGFLWHEGDNYSINAELREESLSDIMPDQFTRTVMFEIDLASGTDEEIAESLKAA
FT                   LPQWRKVKGIDENPLESVRFGYGTIKKLISYRVIPMLDILVWAAVKKIRVSDDRLSRLL
FT                   YTDDDEESEMRQSSQIKDTDRPLALKSCTTDFIRQFHYFMNKNSHLKQMKVSDVMKLSD"
     MNNWSPEHTK DIKSWFKIDT YRKFEDLSLI QFYHEIWARN LFFKEYREEF ESRTLMGYFS        60
     KIFSGNPFLI EEGQLGYMTP ANKLFQPPHF FLTTLDRLAE TSIIAMQRGG FLWHEGDNYS       120
     INAELREESL SDIMPDQFTR TVMFEIDLAS GTDEEIAESL KAALPQWRKV KGIDENPLES       180
     VRFGYGTIKK LISYRVIPML DILVWAAVKK IRVSDDRLSR LLYTDDDEES EMRQSSQIKD       240
     TDRPLALKSC TTDFIRQFHY FMNKNSHLKQ MKVSDVMKLS D                           281
//

If you have problems or comments...

PBIL Back to PBIL home page