(data stored in SCRATCH zone)

EMBL: CP000880.PE210

CP000880.PE210       Location/Qualifiers
FT   CDS             201597..202907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00217"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0582 Integrase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20164"
FT                   /db_xref="GOA:A9MGQ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGQ3"
FT                   /inference="protein motif:Gene3D:IPR013762"
FT                   /inference="protein motif:HMMPfam:IPR002104"
FT                   /inference="protein motif:superfamily:IPR011010"
FT                   /inference="similar to AA sequence:INSD:ABP61566.1"
FT                   /protein_id="ABX20164.1"
FT                   /translation="MNNLIKHSSDKMSIHEHKIVTSIESHGINIRDLICVMNKSLVCGF
FT                   VNTLQYYFCSKSHLYVKTIVKNMKNFINNVSPNYIDDKVIIQYQNMQSANKPSYFRGLR
FT                   PFFTKWFESGYPGIDASAIEIAKHFDLKIKKAGQPILQDDPTVGPLTKEEHTSLIKAMS
FT                   HAYSIGELSLSDYAISLLISLTGRRPQQLVMLEYKDLLQKNLDTGKVEYLISVPRVKQR
FT                   GKQLQYRELPIISEVASIVQLQANHSVRLVEQTLGKTLDDHDKGKVPVFLNEDKLLDLA
FT                   IIDFNFLESNKIYAKPTIANRALKNIVNTVNLISNRTGSLLNATPRRLRYTIATMLARE
FT                   GHNANTIAELLDHSSTSSTGIYIKNLAESVERIDSAVSEQLSFVADAFMNGIKSKEKIH
FT                   LKFCSSRKCQSQNLNVSFPCNECAFFMPVDIGEVNPR"
     MNNLIKHSSD KMSIHEHKIV TSIESHGINI RDLICVMNKS LVCGFVNTLQ YYFCSKSHLY        60
     VKTIVKNMKN FINNVSPNYI DDKVIIQYQN MQSANKPSYF RGLRPFFTKW FESGYPGIDA       120
     SAIEIAKHFD LKIKKAGQPI LQDDPTVGPL TKEEHTSLIK AMSHAYSIGE LSLSDYAISL       180
     LISLTGRRPQ QLVMLEYKDL LQKNLDTGKV EYLISVPRVK QRGKQLQYRE LPIISEVASI       240
     VQLQANHSVR LVEQTLGKTL DDHDKGKVPV FLNEDKLLDL AIIDFNFLES NKIYAKPTIA       300
     NRALKNIVNT VNLISNRTGS LLNATPRRLR YTIATMLARE GHNANTIAEL LDHSSTSSTG       360
     IYIKNLAESV ERIDSAVSEQ LSFVADAFMN GIKSKEKIHL KFCSSRKCQS QNLNVSFPCN       420
     ECAFFMPVDI GEVNPR                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page