(data stored in SCRATCH zone)

EMBL: CP000880.PE221

CP000880.PE221       Location/Qualifiers
FT   CDS             208828..211734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nph:NP0492A 8.9e-35 mer3_1; ATP-dependent DNA
FT                   helicase 1 K03726; COG: COG1204 Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20175"
FT                   /db_xref="GOA:A9MGR4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR4"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01462331.1"
FT                   /protein_id="ABX20175.1"
FT                   /translation="MKYGLPVNCGIDEDVSSPLFYKENDEFCLTDVQYESLDRGVGKGK
FT                   SVLVVSPTSTGKTLVGTVALTQGIQEGKNAVFLVTHRALARQKFEDFKKQLLKDFLDND
FT                   PSALVLATGDIIEDAFGNTVPSPLNAKLMVATYEKYLGILSASGVPKSMKSTVFVCDEI
FT                   QLIGDENRGQQVEILLTLIKRAGWAQLVGLSAVLEHRDALKLSQWLEIELIYTSTREKH
FT                   LTYQCHAHNGEVYSCSTKSPEEITSIKSKQPTSSIARTIKNYLEKNKELTPIIVFCMTK
FT                   KETYTLAQSLVSEYKSPFNTQMDFDFDGVPETLANNMLKEFVQYRVACHSADLIDEERE
FT                   IIERKILDKEIDVVFATSTLAAGVNFPLGTAFFASWQRWNSDLRKNIPIGSSEFHNMAG
FT                   RVGRMGSDHSEGNIIYFSNNNADLTSALKYLKFSDMPPLKSRIEPKGFNRLILQLVASG
FT                   LSNNIIDLKDIVFNTLSGIVEQDTNLKSFNTWDGCLDTSLDMLTAEGLLIKTAAGDLHA
FT                   TSFGKAVSLAGFNPESGVNLLKYFAKYSNWFSQCIFDIESNGNYKKLIISIFYACFSCP
FT                   EFISYQGKRPTRYLPYMFTRAVLLDPSKLDIPLYENIWQANLPSINAAKLAFEWIEGEQ
FT                   LRKLEDTFEALTAGMLNDLYRNLAWLLKGVSTIVMACADTRIASDLRPSFLNDEVVNDL
FT                   RLLPRFINRLAFRVNTGLTDKALWLTTLNKIYPERGFKLTRIEMLNISSSEYYKPEYLS
FT                   QGEQEAEEFRLELFKNIKPTPHKKSNWLRDAAKVWKINQRSLAAERHVLKSKKIGFEKQ
FT                   FKTYYDARGIEYEQAFEVLLSLAEINYIKLDDGKRTGAPDYLLSFTNSPDIVVELKTKL
FT                   GENLVDFNGATDVLRASELYGYGDNFCVTLCHPGVDPSVLPIIEKCGRLSIVEGHDLGE
FT                   ALLRLLSGNLTQEQLWQWLSIPGAASAEDLPMKEYSFN"
     MKYGLPVNCG IDEDVSSPLF YKENDEFCLT DVQYESLDRG VGKGKSVLVV SPTSTGKTLV        60
     GTVALTQGIQ EGKNAVFLVT HRALARQKFE DFKKQLLKDF LDNDPSALVL ATGDIIEDAF       120
     GNTVPSPLNA KLMVATYEKY LGILSASGVP KSMKSTVFVC DEIQLIGDEN RGQQVEILLT       180
     LIKRAGWAQL VGLSAVLEHR DALKLSQWLE IELIYTSTRE KHLTYQCHAH NGEVYSCSTK       240
     SPEEITSIKS KQPTSSIART IKNYLEKNKE LTPIIVFCMT KKETYTLAQS LVSEYKSPFN       300
     TQMDFDFDGV PETLANNMLK EFVQYRVACH SADLIDEERE IIERKILDKE IDVVFATSTL       360
     AAGVNFPLGT AFFASWQRWN SDLRKNIPIG SSEFHNMAGR VGRMGSDHSE GNIIYFSNNN       420
     ADLTSALKYL KFSDMPPLKS RIEPKGFNRL ILQLVASGLS NNIIDLKDIV FNTLSGIVEQ       480
     DTNLKSFNTW DGCLDTSLDM LTAEGLLIKT AAGDLHATSF GKAVSLAGFN PESGVNLLKY       540
     FAKYSNWFSQ CIFDIESNGN YKKLIISIFY ACFSCPEFIS YQGKRPTRYL PYMFTRAVLL       600
     DPSKLDIPLY ENIWQANLPS INAAKLAFEW IEGEQLRKLE DTFEALTAGM LNDLYRNLAW       660
     LLKGVSTIVM ACADTRIASD LRPSFLNDEV VNDLRLLPRF INRLAFRVNT GLTDKALWLT       720
     TLNKIYPERG FKLTRIEMLN ISSSEYYKPE YLSQGEQEAE EFRLELFKNI KPTPHKKSNW       780
     LRDAAKVWKI NQRSLAAERH VLKSKKIGFE KQFKTYYDAR GIEYEQAFEV LLSLAEINYI       840
     KLDDGKRTGA PDYLLSFTNS PDIVVELKTK LGENLVDFNG ATDVLRASEL YGYGDNFCVT       900
     LCHPGVDPSV LPIIEKCGRL SIVEGHDLGE ALLRLLSGNL TQEQLWQWLS IPGAASAEDL       960
     PMKEYSFN                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page