(data stored in SCRATCH zone)

EMBL: CP000880.PE223

CP000880.PE223       Location/Qualifiers
FT   CDS             212683..213030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20177"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGR6"
FT                   /protein_id="ABX20177.1"
FT                   /translation="MNIERKNIAHEGKSSHQFINVAPYLVFFPVFLMVLECSDDIQRKD
FT                   IYRFIFLLSLFMYEVDSWQMIDFETFPSKRTHLQSYINFSRCYHKYVKDNKESAKYMLI
FT                   GFENWLKEIDG"
     MNIERKNIAH EGKSSHQFIN VAPYLVFFPV FLMVLECSDD IQRKDIYRFI FLLSLFMYEV        60
     DSWQMIDFET FPSKRTHLQS YINFSRCYHK YVKDNKESAK YMLIGFENWL KEIDG            115
//

If you have problems or comments...

PBIL Back to PBIL home page