(data stored in SCRATCH zone)

EMBL: CP000880.PE245

CP000880.PE245       Location/Qualifiers
FT   CDS             245017..245364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00253"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0335 Ribosomal protein L19; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20199"
FT                   /db_xref="GOA:A9MGT8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGT8"
FT                   /inference="protein motif:BlastProDom:IPR001857"
FT                   /inference="protein motif:HMMPfam:IPR001857"
FT                   /inference="protein motif:HMMTigr:IPR001857"
FT                   /inference="protein motif:ScanRegExp:IPR001857"
FT                   /inference="similar to AA sequence:INSD:AAX66580.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20199.1"
FT                   /translation="MSNIIKQLEQEQMKQNVPSFRPGDTVEVKVWVVEGTKKRLQAFEG
FT                   VVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSIAVKRRGAVRKAKLYYLRERT
FT                   GKAARIKERLN"
     MSNIIKQLEQ EQMKQNVPSF RPGDTVEVKV WVVEGTKKRL QAFEGVVIAI RNRGLHSAFT        60
     VRKISNGEGV ERVFQTHSPV VDSIAVKRRG AVRKAKLYYL RERTGKAARI KERLN            115
//

If you have problems or comments...

PBIL Back to PBIL home page