(data stored in SCRATCH zone)

EMBL: CP000880.PE26

CP000880.PE26        Location/Qualifiers
FT   CDS             30717..31427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2831 1.5e-121 ygbP;
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
FT                   K00991; COG: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19980"
FT                   /db_xref="GOA:A9MF28"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF28"
FT                   /inference="protein motif:HMMPfam:IPR001228"
FT                   /inference="protein motif:HMMPIR:IPR008233"
FT                   /inference="protein motif:HMMTigr:IPR001228"
FT                   /inference="protein motif:ScanRegExp:IPR001228"
FT                   /inference="similar to AA sequence:REFSEQ:NP_806528.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX19980.1"
FT                   /translation="MAATLLDVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVHAL
FT                   LAHPRVTRVVIVISPGDHRFAQLPLANHPQITVVDGGNERADSVMAGLQAVAQAKWVLV
FT                   HDAARPCLHQDDLARLLAISENSRVGGILASPVRDTMKRGEPGKAAIAHTVERADLWHA
FT                   LTPQFFPRELLHDCLTRALKEGATITDEASALEYCGFHPALVEGRADNIKVTRPEDLAL
FT                   AEFYLTRTIHQEKA"
     MAATLLDVCA VVPAAGFGRR MQTECPKQYL SIGNKTILEH SVHALLAHPR VTRVVIVISP        60
     GDHRFAQLPL ANHPQITVVD GGNERADSVM AGLQAVAQAK WVLVHDAARP CLHQDDLARL       120
     LAISENSRVG GILASPVRDT MKRGEPGKAA IAHTVERADL WHALTPQFFP RELLHDCLTR       180
     ALKEGATITD EASALEYCGF HPALVEGRAD NIKVTRPEDL ALAEFYLTRT IHQEKA           236
//

If you have problems or comments...

PBIL Back to PBIL home page