(data stored in SCRATCH zone)

EMBL: CP000880.PE269

CP000880.PE269       Location/Qualifiers
FT   CDS             277766..278425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2897 1.3e-97 yfiC; hypothetical
FT                   protein YfiC K00599; COG: COG4123 Predicted
FT                   O-methyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20223"
FT                   /db_xref="GOA:A9MGW2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGW2"
FT                   /inference="protein motif:HMMPfam:IPR007848"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:INSD:AAL21536.1"
FT                   /func_characterised="similar sequence"
FT                   /protein_id="ABX20223.1"
FT                   /translation="MKVGTDGILLGAWAPVADVKRILDIGTGSGLLALMLAQRTDDNVP
FT                   VDAVELDAEAAMQAQENVAHSPWAHRITVHTDDIQRWAPRQTVRFDLIISNPPYYEPGV
FT                   ECATPQREQARYTATLDHQTLLAIAADCITEDGFLCVVLPEQIGNAFTQQALSMGWHLR
FT                   LRTDVAENEARLPHRVLLAFSPQAGECFSDRLVIRGPDQHYSESYTALTQAFYLFM"
     MKVGTDGILL GAWAPVADVK RILDIGTGSG LLALMLAQRT DDNVPVDAVE LDAEAAMQAQ        60
     ENVAHSPWAH RITVHTDDIQ RWAPRQTVRF DLIISNPPYY EPGVECATPQ REQARYTATL       120
     DHQTLLAIAA DCITEDGFLC VVLPEQIGNA FTQQALSMGW HLRLRTDVAE NEARLPHRVL       180
     LAFSPQAGEC FSDRLVIRGP DQHYSESYTA LTQAFYLFM                              219
//

If you have problems or comments...

PBIL Back to PBIL home page