(data stored in SCRATCH zone)

EMBL: CP000880.PE283

CP000880.PE283       Location/Qualifiers
FT   CDS             290853..291827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2577 3.6e-175 lepB; leader peptidase
FT                   (signal peptidase I), serine protease K03100; COG: COG0681
FT                   Signal peptidase I; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20237"
FT                   /db_xref="GOA:A9MGX6"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGX6"
FT                   /inference="protein motif:HMMPanther:IPR000223"
FT                   /inference="protein motif:HMMPfam:IPR006198"
FT                   /inference="protein motif:HMMTigr:IPR000223"
FT                   /inference="protein motif:ScanRegExp:IPR000223"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217564.1"
FT                   /protein_id="ABX20237.1"
FT                   /translation="MANMFALILVIATLVTGILWCVDKFVFAPKRRARQAAAQTATGDA
FT                   LDNATLNKVAPKPGWLETGASVFPVLAIVLIVRSFLYEPFQIPSGSMMPTLLIGDFILV
FT                   EKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKITYDPIAK
FT                   EVTIQPGCSSGQACENALPVTYSNVEPSDFVQTFARRNGGEATSGFFEVPLNETKENGI
FT                   RLTERKETLGDVTHRILMVPIAQDQLGMYYQQPGQPLATWVVPPGQYFMMGDNRDNSAD
FT                   SRYWGFVPEANLVGKAVAIWMSFDKQEGEWPTGVRLSRIGGIH"
     MANMFALILV IATLVTGILW CVDKFVFAPK RRARQAAAQT ATGDALDNAT LNKVAPKPGW        60
     LETGASVFPV LAIVLIVRSF LYEPFQIPSG SMMPTLLIGD FILVEKFAYG IKDPIYQKTL       120
     IETGHPKRGD IVVFKYPEDP KLDYIKRAVG LPGDKITYDP IAKEVTIQPG CSSGQACENA       180
     LPVTYSNVEP SDFVQTFARR NGGEATSGFF EVPLNETKEN GIRLTERKET LGDVTHRILM       240
     VPIAQDQLGM YYQQPGQPLA TWVVPPGQYF MMGDNRDNSA DSRYWGFVPE ANLVGKAVAI       300
     WMSFDKQEGE WPTGVRLSRI GGIH                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page