(data stored in SCRATCH zone)

EMBL: CP000880.PE284

CP000880.PE284       Location/Qualifiers
FT   CDS             292778..293683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2554 1.9e-73 GTPase; COG: COG1159
FT                   GTPase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20238"
FT                   /db_xref="GOA:A9MGX7"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MGX7"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMPfam:IPR004044"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="protein motif:HMMTigr:IPR005662"
FT                   /inference="similar to AA sequence:INSD:AAO68002.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20238.1"
FT                   /translation="MSIEKTYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH
FT                   RIVGIHTEGPYQAIYVDTPGLHIEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD
FT                   DEMVLNKLRDGKAPVILAVNKVDNVQEKADLLPHLQFLASQMSFLDIVPISAETGMNVD
FT                   TIASIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFV
FT                   TNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVKV
FT                   KSGWADDERALRSLGYVDDL"
     MSIEKTYCGF IAIVGRPNVG KSTLLNKLLG QKISITSRKA QTTRHRIVGI HTEGPYQAIY        60
     VDTPGLHIEE KRAINRLMNK AASSSIGDVE LVIFVVEGTR WTPDDEMVLN KLRDGKAPVI       120
     LAVNKVDNVQ EKADLLPHLQ FLASQMSFLD IVPISAETGM NVDTIASIVR KHLPEATHHF       180
     PEDYITDRSQ RFMASEIIRE KLMRFLGAEL PYSVTVEIER FVTNERGGYD INGLILVERE       240
     GQKKMVIGNK GAKIKTIGIE ARKDMQEMFE APVHLELWVK VKSGWADDER ALRSLGYVDD       300
     L                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page