(data stored in SCRATCH zone)

EMBL: CP000880.PE291

CP000880.PE291       Location/Qualifiers
FT   CDS             298009..298314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2565 3.6e-27 yfeV; putative
FT                   phosphotransferase system IIB components K02809:K02810;
FT                   COG: COG1264 Phosphotransferase system IIB components;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20245"
FT                   /db_xref="GOA:A9MGY4"
FT                   /db_xref="UniProtKB/TrEMBL:A9MGY4"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457099.1"
FT                   /protein_id="ABX20245.1"
FT                   /translation="MITDIIILKRPDIVGNVSVYYSNLLGLFMWSWCKRMAITRCFPFW
FT                   RWRALISYWKVVKVITFGISLTIVAGKVVFYLLGYLIAVIAGVIFTWLLGFNDPEE"
     MITDIIILKR PDIVGNVSVY YSNLLGLFMW SWCKRMAITR CFPFWRWRAL ISYWKVVKVI        60
     TFGISLTIVA GKVVFYLLGY LIAVIAGVIF TWLLGFNDPE E                           101
//

If you have problems or comments...

PBIL Back to PBIL home page