(data stored in SCRATCH zone)

EMBL: CP000880.PE302

CP000880.PE302       Location/Qualifiers
FT   CDS             complement(311251..313395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0297 0. cadA; lysine decarboxylase
FT                   K01582; COG: COG1982 Arginine/lysine/ornithine
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20256"
FT                   /db_xref="GOA:A9MHH8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHH8"
FT                   /inference="protein motif:HMMPfam:IPR000310"
FT                   /inference="protein motif:HMMPfam:IPR005308"
FT                   /inference="protein motif:HMMPfam:IPR008286"
FT                   /inference="protein motif:HMMPIR:IPR011193"
FT                   /inference="protein motif:ScanRegExp:IPR000310"
FT                   /inference="protein motif:superfamily:IPR008286"
FT                   /protein_id="ABX20256.1"
FT                   /translation="MNVIAIMNHMGVYFKEEPIRELHRALEGLNFRIVYPNDREDLLKL
FT                   IENNARLCGVIFDWDKYNLELCEEISKLNEYMPLYAFANSYSTLDVSLNDLRMQVRFFE
FT                   YALGAAADIAAKIRQNTDEYIDNILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPV
FT                   GSIFYDFFGPNTMKSDISISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTST
FT                   ANKIVGMYSAPAGSTVLIDRNCHKSLTHLMMMSDITPIYFRPTRNAYGILGGIPQSEFQ
FT                   HATIAKRVKETPNATWPVHAVITNSTYDGLLYNTDYIKKTLDVKSIHFDSAWVPYTNFS
FT                   PIYEGKCGMSGDRVEGKIIYETQSTHKLLAAFSQASMIHVKGDINEETFNEAYMMHTTT
FT                   SPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRLKSESDGWFFDVWQPEH
FT                   IDGAECWPLRSDSAWHGFKNIDNEHMYLDPIKVTILTPGMKKDGTMDEFGIPASLVAKY
FT                   LDERGIIVEKTGPYNLLFLFSIGIDKTKALSLLRALTEFKRAFDLNLRVKNILPALYRE
FT                   APEFYENMRIQELAQNIHKLVEHHNLPDLMYRAFEVLPKMVMTPYTAFQKELHGETEEV
FT                   YLEEMVGRVNANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHYPGFETDIH
FT                   GAYRQADGRYTVKVLKENTK"
     MNVIAIMNHM GVYFKEEPIR ELHRALEGLN FRIVYPNDRE DLLKLIENNA RLCGVIFDWD        60
     KYNLELCEEI SKLNEYMPLY AFANSYSTLD VSLNDLRMQV RFFEYALGAA ADIAAKIRQN       120
     TDEYIDNILP PLTKALFKYV REGKYTFCTP GHMGGTAFQK SPVGSIFYDF FGPNTMKSDI       180
     SISVSELGSL LDHSGPHKEA EEYIARVFNA ERSYMVTNGT STANKIVGMY SAPAGSTVLI       240
     DRNCHKSLTH LMMMSDITPI YFRPTRNAYG ILGGIPQSEF QHATIAKRVK ETPNATWPVH       300
     AVITNSTYDG LLYNTDYIKK TLDVKSIHFD SAWVPYTNFS PIYEGKCGMS GDRVEGKIIY       360
     ETQSTHKLLA AFSQASMIHV KGDINEETFN EAYMMHTTTS PHYGIVASTE TAAAMMKGNA       420
     GKRLINGSIE RAIKFRKEIK RLKSESDGWF FDVWQPEHID GAECWPLRSD SAWHGFKNID       480
     NEHMYLDPIK VTILTPGMKK DGTMDEFGIP ASLVAKYLDE RGIIVEKTGP YNLLFLFSIG       540
     IDKTKALSLL RALTEFKRAF DLNLRVKNIL PALYREAPEF YENMRIQELA QNIHKLVEHH       600
     NLPDLMYRAF EVLPKMVMTP YTAFQKELHG ETEEVYLEEM VGRVNANMIL PYPPGVPLVM       660
     PGEMITEESR PVLEFLQMLC EIGAHYPGFE TDIHGAYRQA DGRYTVKVLK ENTK             714
//

If you have problems or comments...

PBIL Back to PBIL home page