(data stored in SCRATCH zone)

EMBL: CP000880.PE306

CP000880.PE306       Location/Qualifiers
FT   CDS             318133..318264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20260"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHI2"
FT                   /protein_id="ABX20260.1"
FT                   /translation="MPLNCKWFFAALSCERNNVKNLHHKAEKKSVEIRNAPVQENLI"
     MPLNCKWFFA ALSCERNNVK NLHHKAEKKS VEIRNAPVQE NLI                          43
//

If you have problems or comments...

PBIL Back to PBIL home page