(data stored in SCRATCH zone)

EMBL: CP000880.PE324

CP000880.PE324       Location/Qualifiers
FT   CDS             334631..334831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00339"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2975 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20278"
FT                   /db_xref="GOA:A9MHK0"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHK0"
FT                   /inference="protein motif:HMMPfam:IPR007479"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457068.1"
FT                   /protein_id="ABX20278.1"
FT                   /translation="MGLKWTDSREIGEALYDAYPDVDPKTVRFTDLHQWICELDDFDDD
FT                   PNASNEKILEAILLVWLDEAE"
     MGLKWTDSRE IGEALYDAYP DVDPKTVRFT DLHQWICELD DFDDDPNASN EKILEAILLV        60
     WLDEAE                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page