(data stored in SCRATCH zone)

EMBL: CP000880.PE35

CP000880.PE35        Location/Qualifiers
FT   CDS             complement(36962..38389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll3010 3.8e-52
FT                   3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD K03182;
FT                   COG: COG0043 3-polyprenyl-4-hydroxybenzoate decarboxylase
FT                   and related decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19989"
FT                   /db_xref="GOA:A9MF37"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR032902"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF37"
FT                   /inference="protein motif:HMMPfam:IPR002830"
FT                   /inference="protein motif:HMMTigr:IPR002830"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461843.1"
FT                   /protein_id="ABX19989.1"
FT                   /translation="MAFDDLRSFLHALDQQGQLLKISEEVNAEPDLAAAANATGRIGDG
FT                   APALWFDNIRGFTDARVAMNTIGSWQNHAISLGLPPNTPVKKQIDEFIRRWDNFPVAPE
FT                   RRANPGWAENTVDGDAINLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDNFGKQNVG
FT                   IYRMEVKGKRKLGLQPVPMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATPLKYD
FT                   QSEYEMAGALRESPYPIATAPLTGFDVPWGSEVILEGVIESRKREIEGPFGEFTDHYSG
FT                   GRNMTVVRIDKVSYRSKPIFESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFPEVQAVN
FT                   AMYTHGLLAIISTKKRYGGFARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFNLPQVMWA
FT                   LSSKVNPAGDLVQLPNMSVLELDPGSSPAGITDKLIIDATTPVAPDNRGHYSQPVSDLP
FT                   ETKAWAEKLTAMLANRK"
     MAFDDLRSFL HALDQQGQLL KISEEVNAEP DLAAAANATG RIGDGAPALW FDNIRGFTDA        60
     RVAMNTIGSW QNHAISLGLP PNTPVKKQID EFIRRWDNFP VAPERRANPG WAENTVDGDA       120
     INLFDILPLF RLNDGDGGFY LDKACVVSRD PLDPDNFGKQ NVGIYRMEVK GKRKLGLQPV       180
     PMHDIALHLH KAEERGEDLP IAITLGNDPI ITLMGATPLK YDQSEYEMAG ALRESPYPIA       240
     TAPLTGFDVP WGSEVILEGV IESRKREIEG PFGEFTDHYS GGRNMTVVRI DKVSYRSKPI       300
     FESLYLGMPW TEIDYLMGPA TCVPLYQQLK AEFPEVQAVN AMYTHGLLAI ISTKKRYGGF       360
     ARAVGLRAMT TPHGLGYVKM VIMVDEDVDP FNLPQVMWAL SSKVNPAGDL VQLPNMSVLE       420
     LDPGSSPAGI TDKLIIDATT PVAPDNRGHY SQPVSDLPET KAWAEKLTAM LANRK            475
//

If you have problems or comments...

PBIL Back to PBIL home page