(data stored in SCRATCH zone)

EMBL: CP000880.PE354

CP000880.PE354       Location/Qualifiers
FT   CDS             complement(370331..372802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00371"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20308"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHN0"
FT                   /inference="protein motif:HMMPfam:IPR006533"
FT                   /inference="protein motif:HMMTigr:IPR006533"
FT                   /inference="similar to AA sequence:INSD:ABP58869.1"
FT                   /protein_id="ABX20308.1"
FT                   /translation="MDNWSALFDGQTRYGLDINDSTMKADVLRFRGREALSEPFNWDIE
FT                   FTTLQANIPPEQVLMKYASFRMRNGKNVHGMVTRLEWLSTSRDQSHYRLTLSSRLTLLG
FT                   YTRQCAVYQNQSVPEVVEQVLRKHGLEGPDFEFRLERTYPARELITQWQETDLQFIQRI
FT                   LSEVGIYWRTMMDDVRGLDTYILADSQLNYQFDVQLPYSEPSGLFDGAAESVWDVRTWH
FT                   NIATGTVATRNYNYRTATTPMDATVSVRNDAVTTGEHYRYAAPYRVAGDDASPEPETES
FT                   GAFYARIHHERELNRSARIHLFSNAAHLTPGQVLEPQGDAITALKEGVILTQVTYRGAR
FT                   DSRLHVSVWGLPYTERYCFRPVEVPRPVIPGTLPARIESREKNDIYAHLDEQGRYRVKL
FT                   DFDREGTESGYGYLWLRMAKPYAGETLGWHTPLIDGTEVAIAYSNGDIDLPYIAYALHD
FT                   SEHPDHVTRDNHTRNVLRTPANNKLRMEDRRGEEHVRLATEYGKTQLNSGHLVDAQGQR
FT                   RGTGAELRTDEWGTIRAGKGLFVSADAQAKAQGEVLDMDAALKEIDRLNQQLQQLEMAA
FT                   EKAQALKADVDSQIQMFEQRLKPLSEVVLFSAPEGMALTSGEHLQMTATKNVAMNAGGN
FT                   FSAGVMGNLTALAGEKLGLFARTGQLSLKVSEGPVEVQAQNASMRLFAEKKLTLSSASD
FT                   ISFAGKKRITLVGGGSYLRLEAGKVEYGTTATYLRRVKRTMFAGAHSTPTSSVLMPLVE
FT                   DLIKDGFFDEQFRILNDSGKPMANVPYFISTESGETFKGVTDNQGLCKRVFSKEASKLT
FT                   VWLGVQALERW"
     MDNWSALFDG QTRYGLDIND STMKADVLRF RGREALSEPF NWDIEFTTLQ ANIPPEQVLM        60
     KYASFRMRNG KNVHGMVTRL EWLSTSRDQS HYRLTLSSRL TLLGYTRQCA VYQNQSVPEV       120
     VEQVLRKHGL EGPDFEFRLE RTYPARELIT QWQETDLQFI QRILSEVGIY WRTMMDDVRG       180
     LDTYILADSQ LNYQFDVQLP YSEPSGLFDG AAESVWDVRT WHNIATGTVA TRNYNYRTAT       240
     TPMDATVSVR NDAVTTGEHY RYAAPYRVAG DDASPEPETE SGAFYARIHH ERELNRSARI       300
     HLFSNAAHLT PGQVLEPQGD AITALKEGVI LTQVTYRGAR DSRLHVSVWG LPYTERYCFR       360
     PVEVPRPVIP GTLPARIESR EKNDIYAHLD EQGRYRVKLD FDREGTESGY GYLWLRMAKP       420
     YAGETLGWHT PLIDGTEVAI AYSNGDIDLP YIAYALHDSE HPDHVTRDNH TRNVLRTPAN       480
     NKLRMEDRRG EEHVRLATEY GKTQLNSGHL VDAQGQRRGT GAELRTDEWG TIRAGKGLFV       540
     SADAQAKAQG EVLDMDAALK EIDRLNQQLQ QLEMAAEKAQ ALKADVDSQI QMFEQRLKPL       600
     SEVVLFSAPE GMALTSGEHL QMTATKNVAM NAGGNFSAGV MGNLTALAGE KLGLFARTGQ       660
     LSLKVSEGPV EVQAQNASMR LFAEKKLTLS SASDISFAGK KRITLVGGGS YLRLEAGKVE       720
     YGTTATYLRR VKRTMFAGAH STPTSSVLMP LVEDLIKDGF FDEQFRILND SGKPMANVPY       780
     FISTESGETF KGVTDNQGLC KRVFSKEASK LTVWLGVQAL ERW                         823
//

If you have problems or comments...

PBIL Back to PBIL home page