(data stored in SCRATCH zone)

EMBL: CP000880.PE391

CP000880.PE391       Location/Qualifiers
FT   CDS             complement(413603..415603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2474 0. tktB; transketolase K00615;
FT                   COG: COG0021 Transketolase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20345"
FT                   /db_xref="GOA:A9MHR7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A9MHR7"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPanther:IPR005478"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR005478"
FT                   /inference="protein motif:HMMTigr:IPR005478"
FT                   /inference="protein motif:ScanRegExp:IPR005474"
FT                   /inference="protein motif:ScanRegExp:IPR005475"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /protein_id="ABX20345.1"
FT                   /translation="MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLK
FT                   HNPTDPAWYDRDRFILSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGY
FT                   TPGVETTTGPLGQGLANAVGLAIAERTLGAQFNQPDHEIVDHYTYVFMGDGCLMEGISH
FT                   EVCSLAGTLGLGKLIGFYDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHDIDGHDPEA
FT                   VKKAILEARSVKDKPSLIICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHP
FT                   AFEIPKEIYRAWDGREKGEKAQQRWQEKFAAYEKAYPELAAEFTRRMSGGLPEAWESAT
FT                   QKFINDLQANPAKIATRKASQNTLNAYGPLLPELLGGSADLAPSNLTIWKGSTSLKEDP
FT                   AGNYIHYGVREFGMTAIANGIAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVY
FT                   THDSIGLGEDGPTHQAVEQLASLRLTPNFSTWRPCDQVEAAVGWKLAIERHHGPTALIL
FT                   SRQNLAQVERTPEQVKAIARGGYILKDSGGKPDIILIATGSEMEITLQAAEKLTGEGHN
FT                   VRVVSLPSTDIFDAQEEAYRESVLPSHVTARVAVEAGIADYWYKYVGLKGAIIGMTGYG
FT                   ESAPADKLFPYFGFTVENIVEKARRVLSMKG"
     MSRKDLANAI RALSMDAVQK ANSGHPGAPM GMADIAEVLW NDFLKHNPTD PAWYDRDRFI        60
     LSNGHASMLL YSLLHLTGYD LPLEELKNFR QLHSKTPGHP EIGYTPGVET TTGPLGQGLA       120
     NAVGLAIAER TLGAQFNQPD HEIVDHYTYV FMGDGCLMEG ISHEVCSLAG TLGLGKLIGF       180
     YDHNGISIDG ETEGWFTDDT AKRFEAYHWH VVHDIDGHDP EAVKKAILEA RSVKDKPSLI       240
     ICRTVIGFGS PNKAGKEESH GAALGEEEVA LTRQKLGWHH PAFEIPKEIY RAWDGREKGE       300
     KAQQRWQEKF AAYEKAYPEL AAEFTRRMSG GLPEAWESAT QKFINDLQAN PAKIATRKAS       360
     QNTLNAYGPL LPELLGGSAD LAPSNLTIWK GSTSLKEDPA GNYIHYGVRE FGMTAIANGI       420
     AHHGGFVPYT ATFLMFVEYA RNAARMAALM KARQIMVYTH DSIGLGEDGP THQAVEQLAS       480
     LRLTPNFSTW RPCDQVEAAV GWKLAIERHH GPTALILSRQ NLAQVERTPE QVKAIARGGY       540
     ILKDSGGKPD IILIATGSEM EITLQAAEKL TGEGHNVRVV SLPSTDIFDA QEEAYRESVL       600
     PSHVTARVAV EAGIADYWYK YVGLKGAIIG MTGYGESAPA DKLFPYFGFT VENIVEKARR       660
     VLSMKG                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page