(data stored in SCRATCH zone)

EMBL: CP000880.PE393

CP000880.PE393       Location/Qualifiers
FT   CDS             416846..419125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2709 0. maeB; NADP-dependent malate
FT                   dehydrogenase (decarboxylating) K00029; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20347"
FT                   /db_xref="GOA:A9MIB0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB0"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR012301"
FT                   /inference="protein motif:HMMPfam:IPR012302"
FT                   /inference="protein motif:HMMPIR:IPR012188"
FT                   /inference="protein motif:ScanRegExp:IPR001891"
FT                   /protein_id="ABX20347.1"
FT                   /translation="MDEQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAA
FT                   PCLEIEKDPLAAYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGI
FT                   DVFDIEVDELDPDKFINVVAALEPTFGGVNLEDIKAPECFYIEQKLRERMNIPVFHDDQ
FT                   HGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGMQKHNIVVCDSK
FT                   GVIYKGREPNMAETKAAYAVDDSGKRTLDDVIDGADIFLGCSGPKVLTQEMVKKMARAP
FT                   MILALANPEPEILPPLAKEVRPDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAIN
FT                   EEMKLAAVHAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPIADFDAYIDKLTEFVYKTNLFMKPIFSQARKDPQRVVLPEGEEARVLHA
FT                   TQELITLGLAKPILIGRPSVIEMRIQKLGLQIKAGVDFEIVNNESDPRFKEYWSEYYQI
FT                   MKRRGVTQEQAQRAMIGNHTAIGAIMVQRGEADAMICGTIGDYHEHFGVVKAVFDYRDG
FT                   VHTAGAMNALLLPSGNTFIADTYVNEDPTPEQLAEITVMAAETVRRFGIEPKVALLSHS
FT                   NFGSSNSLSASKMRETLERVRERAPDLMIDGEMHGDAALVESIRNDRMPDSSLKGAANI
FT                   LVMPNMEAARISYNLLRVSSSEGVTVGPVLMGVSKPVHVLTPIASVRRIVNMVALAVVE
FT                   AQTTPL"
     MDEQLKQSAL DFHEFPVPGK IQVSPTKPLA TQRDLALAYS PGVAAPCLEI EKDPLAAYKY        60
     TARGNLVAVI SNGTAVLGLG NIGALAGKPV MEGKGVLFKK FAGIDVFDIE VDELDPDKFI       120
     NVVAALEPTF GGVNLEDIKA PECFYIEQKL RERMNIPVFH DDQHGTAIIS TAAILNGLRV       180
     VEKNISDVRM VVSGAGAAAI ACMNLLVALG MQKHNIVVCD SKGVIYKGRE PNMAETKAAY       240
     AVDDSGKRTL DDVIDGADIF LGCSGPKVLT QEMVKKMARA PMILALANPE PEILPPLAKE       300
     VRPDAIICTG RSDYPNQVNN VLCFPFIFRG ALDVGATAIN EEMKLAAVHA IAELAHAEQS       360
     EVVASAYGDQ DLSFGPEYII PKPFDPRLIV KIAPAVAKAA MDSGVATRPI ADFDAYIDKL       420
     TEFVYKTNLF MKPIFSQARK DPQRVVLPEG EEARVLHATQ ELITLGLAKP ILIGRPSVIE       480
     MRIQKLGLQI KAGVDFEIVN NESDPRFKEY WSEYYQIMKR RGVTQEQAQR AMIGNHTAIG       540
     AIMVQRGEAD AMICGTIGDY HEHFGVVKAV FDYRDGVHTA GAMNALLLPS GNTFIADTYV       600
     NEDPTPEQLA EITVMAAETV RRFGIEPKVA LLSHSNFGSS NSLSASKMRE TLERVRERAP       660
     DLMIDGEMHG DAALVESIRN DRMPDSSLKG AANILVMPNM EAARISYNLL RVSSSEGVTV       720
     GPVLMGVSKP VHVLTPIASV RRIVNMVALA VVEAQTTPL                              759
//

If you have problems or comments...

PBIL Back to PBIL home page