(data stored in SCRATCH zone)

EMBL: CP000880.PE40

CP000880.PE40        Location/Qualifiers
FT   CDS             42905..43285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00041"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4460 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19994"
FT                   /db_xref="InterPro:IPR016918"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF42"
FT                   /inference="similar to AA sequence:INSD:AAL21790.1"
FT                   /protein_id="ABX19994.1"
FT                   /translation="MNSYKEEILHTHVAIENWLSRGAGSLEALLQRFAADFSMVTPGGA
FT                   CLDYPALGAFFQAQRACRPGLVIVVEHIDLVAEWPEGAALRYRERQQLPGQAETVRWST
FT                   VILKRERGRIVWRHLHETTVTA"
     MNSYKEEILH THVAIENWLS RGAGSLEALL QRFAADFSMV TPGGACLDYP ALGAFFQAQR        60
     ACRPGLVIVV EHIDLVAEWP EGAALRYRER QQLPGQAETV RWSTVILKRE RGRIVWRHLH       120
     ETTVTA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page