(data stored in SCRATCH zone)

EMBL: CP000880.PE401

CP000880.PE401       Location/Qualifiers
FT   CDS             426182..426472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00419"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20355"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIB8"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:INSD:AAV76414.1"
FT                   /protein_id="ABX20355.1"
FT                   /translation="MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLVTAMV
FT                   RGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPISFKGDSNI"
     MEALGMIETR GLVALIEASD AMVKAARVKL VGVKQIGGGL VTAMVRGDVA ACKAATDAGA        60
     AAAQRIGELV SVHVIPRPHG DLEEVFPISF KGDSNI                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page