(data stored in SCRATCH zone)

EMBL: CP000880.PE410

CP000880.PE410       Location/Qualifiers
FT   CDS             435284..435943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00428"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4816 Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20364"
FT                   /db_xref="GOA:A9MIC7"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIC7"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009193"
FT                   /inference="similar to AA sequence:INSD:AAX66360.1"
FT                   /protein_id="ABX20364.1"
FT                   /translation="MPALDLIRPSVTAMRVIASVNDGFARELKLPPHIRSLGLITADSD
FT                   DVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMV
FT                   ASIENGAAFQWANDAENTAFLAHVVSRTGSYLSSTAGIALGDPMAYLVAPPLEATFGID
FT                   AAMKSADVQLVTYVPPPSETNYSAAFLTGSQAACKAACNAFADAVLDIARNPVQRA"
     MPALDLIRPS VTAMRVIASV NDGFARELKL PPHIRSLGLI TADSDDVTYI AADEATKQAM        60
     VEVVYGRSLY AGAAHGPSPT AGEVLIMLGG PNPAEVRAGL DAMVASIENG AAFQWANDAE       120
     NTAFLAHVVS RTGSYLSSTA GIALGDPMAY LVAPPLEATF GIDAAMKSAD VQLVTYVPPP       180
     SETNYSAAFL TGSQAACKAA CNAFADAVLD IARNPVQRA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page