(data stored in SCRATCH zone)

EMBL: CP000880.PE414

CP000880.PE414       Location/Qualifiers
FT   CDS             complement(438566..439435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2687 1.0e-147 amiA; probable
FT                   N-acetylmuramoyl-L-alanine amidase K01448; COG: COG0860
FT                   N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20368"
FT                   /db_xref="GOA:A9MID1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID1"
FT                   /inference="protein motif:HMMPfam:IPR002508"
FT                   /inference="protein motif:HMMSmart:IPR002508"
FT                   /inference="similar to AA sequence:INSD:CAD07681.1"
FT                   /protein_id="ABX20368.1"
FT                   /translation="MSNFKLLKTLTSRRQVLKTGLAALTLSGMSHALAKEDTLKTSNGH
FT                   SKPKTKKTGNKRLVMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHGIDARL
FT                   TRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFALSNRGASSAMAKYL
FT                   SERENRADEVAGKKATDRDHLLQQVLFDLVQTDTIKNSLTLGSHIIKKIKPIHKLHSRT
FT                   TEQAAFVVLKSPSIPSVLVETSFITNPEEERLLGTTAFRQKIATAIANGIISYFHWFDN
FT                   QKAHTKKR"
     MSNFKLLKTL TSRRQVLKTG LAALTLSGMS HALAKEDTLK TSNGHSKPKT KKTGNKRLVM        60
     LDPGHGGIDT GAIGRNGSQE KHVVLAIAKN VRAILRNHGI DARLTRTGDT FIPLYDRVEI       120
     AHKHGADLFM SIHADGFTNP KAAGASVFAL SNRGASSAMA KYLSERENRA DEVAGKKATD       180
     RDHLLQQVLF DLVQTDTIKN SLTLGSHIIK KIKPIHKLHS RTTEQAAFVV LKSPSIPSVL       240
     VETSFITNPE EERLLGTTAF RQKIATAIAN GIISYFHWFD NQKAHTKKR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page