(data stored in SCRATCH zone)

EMBL: CP000880.PE415

CP000880.PE415       Location/Qualifiers
FT   CDS             439648..440073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2767 4.7e-70 ypeA; hypothetical
FT                   protein YpeA K00680; COG: COG0456 Acetyltransferases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20369"
FT                   /db_xref="GOA:A9MID2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="InterPro:IPR023072"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID2"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:SwissProt:P63423"
FT                   /protein_id="ABX20369.1"
FT                   /translation="MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKVNHDVSLF
FT                   LVAEVSGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQ
FT                   IMVRDDNDVVLGMYERLGYEHSDALSLGKRLIEDEEY"
     MEIRVFRQED FEEVITLWER CDLLRPWNDP EMDIERKVNH DVSLFLVAEV SGEVVGTVMG        60
     GYDGHRGSAY YLGVHPEFRG RGIANALLNR LEKKLIARGC PKIQIMVRDD NDVVLGMYER       120
     LGYEHSDALS LGKRLIEDEE Y                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page