(data stored in SCRATCH zone)

EMBL: CP000880.PE420

CP000880.PE420       Location/Qualifiers
FT   CDS             complement(443496..444926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2451 3.4e-218 putative PTS system IIBC
FT                   component YfdV K02809:K02810; COG: COG1263
FT                   Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20374"
FT                   /db_xref="GOA:A9MID7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID7"
FT                   /inference="protein motif:HMMPfam:IPR001996"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:ScanRegExp:IPR001996"
FT                   /inference="similar to AA sequence:REFSEQ:YP_670341.1"
FT                   /protein_id="ABX20374.1"
FT                   /translation="MAKEISNDLLKAILARVGGPANIATCGNCMTRLRLSVHDSTQVDP
FT                   AIRTLEGVKGVVLSDNQVQVIFGPGKAQRAADAMNALLANSGETLMQAADIAAKTKSQL
FT                   KAKQTSGVQQFLSKFATIFTPLIPGFIAAGLLLGIATLIGTVMHLPADAQGMLADALNL
FT                   MKVFSKGLFTFLVILIGYNAAQAFGGTGVNGAIIASLFLLGYNPAATTGYFSGIQDFFG
FT                   LPIDPRGNIIGVLIAAWASARIECIIRRFMPDDLDMLLTSMLTLLVTAALAYLIIMPLG
FT                   GWLFEGMSWLFIHLNSNPLGCAVLAGLFLVSVVFGVHQGFIPVYLALMSSQGFNSLFPI
FT                   LSMAGAGQVGAALALYWRAERHSALRSQVRGAIIPGLLGVGEPLIYGVTLPRMKPFITA
FT                   CLGGAAGGLFIGLVAWSGLPMGLNSAFGPSGLVALPLMTSAQGILPAMAVYAAGMAISY
FT                   LGGFIFTVLFGCRNVNLD"
     MAKEISNDLL KAILARVGGP ANIATCGNCM TRLRLSVHDS TQVDPAIRTL EGVKGVVLSD        60
     NQVQVIFGPG KAQRAADAMN ALLANSGETL MQAADIAAKT KSQLKAKQTS GVQQFLSKFA       120
     TIFTPLIPGF IAAGLLLGIA TLIGTVMHLP ADAQGMLADA LNLMKVFSKG LFTFLVILIG       180
     YNAAQAFGGT GVNGAIIASL FLLGYNPAAT TGYFSGIQDF FGLPIDPRGN IIGVLIAAWA       240
     SARIECIIRR FMPDDLDMLL TSMLTLLVTA ALAYLIIMPL GGWLFEGMSW LFIHLNSNPL       300
     GCAVLAGLFL VSVVFGVHQG FIPVYLALMS SQGFNSLFPI LSMAGAGQVG AALALYWRAE       360
     RHSALRSQVR GAIIPGLLGV GEPLIYGVTL PRMKPFITAC LGGAAGGLFI GLVAWSGLPM       420
     GLNSAFGPSG LVALPLMTSA QGILPAMAVY AAGMAISYLG GFIFTVLFGC RNVNLD           476
//

If you have problems or comments...

PBIL Back to PBIL home page