(data stored in SCRATCH zone)

EMBL: CP000880.PE421

CP000880.PE421       Location/Qualifiers
FT   CDS             complement(444932..445828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2606 6.0e-06
FT                   glucosamine--fructose-6-phosphate aminotransferase,
FT                   isomerizing K00820; COG: COG2103 Predicted sugar phosphate
FT                   isomerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20375"
FT                   /db_xref="GOA:A9MID8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A9MID8"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005488"
FT                   /inference="protein motif:ScanRegExp:IPR005486"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311326.1"
FT                   /protein_id="ABX20375.1"
FT                   /translation="MQLENLMTESVNRASLEIDRVSTLDMCRIINNEDKTVPLAVEKVL
FT                   PAIATAIDVIYAQVSAGGRMIYIGAGTSGRLGILDASECPPTYGVSPGLVIGLIAGGEQ
FT                   AIQHAIEGAEDDGEGGETDLQHIALSENDVVIGIAASGRTPYVIAGLEYARSLGCRTVG
FT                   ISCNPGSAVANAAEIAITPVVGPEVVSGSSRMKAGTAQKLILNMLSTGLMIKSGKVFGN
FT                   LMVDVVATNEKLHLRQITIVKNATGCTRQEAEAALSACGRHCKTAIVMLLKNLNAAEAS
FT                   LRLEQHGGFIRQVLEKE"
     MQLENLMTES VNRASLEIDR VSTLDMCRII NNEDKTVPLA VEKVLPAIAT AIDVIYAQVS        60
     AGGRMIYIGA GTSGRLGILD ASECPPTYGV SPGLVIGLIA GGEQAIQHAI EGAEDDGEGG       120
     ETDLQHIALS ENDVVIGIAA SGRTPYVIAG LEYARSLGCR TVGISCNPGS AVANAAEIAI       180
     TPVVGPEVVS GSSRMKAGTA QKLILNMLST GLMIKSGKVF GNLMVDVVAT NEKLHLRQIT       240
     IVKNATGCTR QEAEAALSAC GRHCKTAIVM LLKNLNAAEA SLRLEQHGGF IRQVLEKE         298
//

If you have problems or comments...

PBIL Back to PBIL home page