(data stored in SCRATCH zone)

EMBL: CP000880.PE423

CP000880.PE423       Location/Qualifiers
FT   CDS             complement(446458..447543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00441"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3203 Outer membrane protein (porin); Psort
FT                   location: OuterMembrane, score:9.93"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20377"
FT                   /db_xref="GOA:A9MIE0"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE0"
FT                   /inference="protein motif:HMMPfam:IPR001702"
FT                   /inference="similar to AA sequence:REFSEQ:YP_854940.1"
FT                   /protein_id="ABX20377.1"
FT                   /translation="MKLTLKSLATLTLLATSASHAAVIYQANDGSNIDLYGRLGFNISD
FT                   KKTGDTSGDFDARIGFSARQAINDKLAVIGFTQYQVNAAEYANNISAEDPDDFTARYVW
FT                   AGIDFSEYGKLTGGRVSSGLIMFTDIGDVFASSDVAMARQANFVDPTAVQVFRQDGTIQ
FT                   YQNTFGNLDFSTAYILGNNTSDLDYGYNAALRYTLDMGEFGRLQPVIAGQTEKASHDKT
FT                   SAQSDDNADKYTFYGIGTRYYLGDVMLGLLVAQDKVSYLDGSPDSTDTDYEATLVWNVS
FT                   PDWALRTGYRHLKNEDGDGLKLRDTTFEAQYKLTVRSSVFASYSWRNGEKGTKRTNGSD
FT                   VSFGGSNPADDYFHLGLRYEF"
     MKLTLKSLAT LTLLATSASH AAVIYQANDG SNIDLYGRLG FNISDKKTGD TSGDFDARIG        60
     FSARQAINDK LAVIGFTQYQ VNAAEYANNI SAEDPDDFTA RYVWAGIDFS EYGKLTGGRV       120
     SSGLIMFTDI GDVFASSDVA MARQANFVDP TAVQVFRQDG TIQYQNTFGN LDFSTAYILG       180
     NNTSDLDYGY NAALRYTLDM GEFGRLQPVI AGQTEKASHD KTSAQSDDNA DKYTFYGIGT       240
     RYYLGDVMLG LLVAQDKVSY LDGSPDSTDT DYEATLVWNV SPDWALRTGY RHLKNEDGDG       300
     LKLRDTTFEA QYKLTVRSSV FASYSWRNGE KGTKRTNGSD VSFGGSNPAD DYFHLGLRYE       360
     F                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page