(data stored in SCRATCH zone)

EMBL: CP000880.PE430

CP000880.PE430       Location/Qualifiers
FT   CDS             453605..454462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2440 3.7e-141 cysM; cysteine synthase B
FT                   (O-acetylserine sulfhydrolase B) K01738; COG: COG0031
FT                   Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20384"
FT                   /db_xref="GOA:A9MIE7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE7"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005858"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:INSD:AAL21334.1"
FT                   /protein_id="ABX20384.1"
FT                   /translation="MTPDNGSEIWVKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDV
FT                   LIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRSAMRAYGAELVLVTKEQGMEGA
FT                   RDLALSMAERGEGKLLDQFNNPDNPYAHYATTGPEIWRQTAGRITHFVSSMGTTGTITG
FT                   VSRFLREQDKAVTIVGLQPEEGSCIPGIRRWPADYMPGIFSAPLVDEVLDIHQQEAENT
FT                   MRELAVREGIFCGVSSGGAVAGAIRIAKANPGALVVAIICDRGDRYLSTGVFGEEHFSQ
FT                   GAGI"
     MTPDNGSEIW VKLEGNNPAG SVKDRAALSM IVEAEKRGEI KPGDVLIEAT SGNTGIALAM        60
     IAALKGYRMK LLMPDNMSQE RRSAMRAYGA ELVLVTKEQG MEGARDLALS MAERGEGKLL       120
     DQFNNPDNPY AHYATTGPEI WRQTAGRITH FVSSMGTTGT ITGVSRFLRE QDKAVTIVGL       180
     QPEEGSCIPG IRRWPADYMP GIFSAPLVDE VLDIHQQEAE NTMRELAVRE GIFCGVSSGG       240
     AVAGAIRIAK ANPGALVVAI ICDRGDRYLS TGVFGEEHFS QGAGI                       285
//

If you have problems or comments...

PBIL Back to PBIL home page