(data stored in SCRATCH zone)

EMBL: CP000880.PE432

CP000880.PE432       Location/Qualifiers
FT   CDS             complement(455277..456569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0881 2.0e-25 transcriptional
FT                   regulatory protein GntR family K00825; COG: COG1167
FT                   Transcriptional regulators containing a DNA-binding HTH
FT                   domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20386"
FT                   /db_xref="GOA:A9MIE9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIE9"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:SwissProt:P40193"
FT                   /protein_id="ABX20386.1"
FT                   /translation="MINGKTASEIFNSIRQHITAGTLRAEDSLPPVRELASELKVNRNT
FT                   VAAAYKRLITAGLAQSLGRNGTVIKGSPSPVALEGGDPHTPLRDLSGGNPDPQRLPDLS
FT                   RYFARLSRTPHLYGDAPVSPELHAWAVRWLQDAMPVAGEIDITSGAIDAIERLLCAHLL
FT                   PGDSVAVEDPCFLSSINMLRYAGFSASPVSVDSEGMQPEKLEQALSQGARAVILTPRAH
FT                   NPTGCSLSALRAAALQNILARYPQILVIIDDHFALLSSSPWQPVIAQATQHWAVIRSVS
FT                   KTLGPDLRLAIIASDSATSAKLRLRLNAGSQWVSHLLQDLVCACLTDPEYQHRLTQTRL
FT                   FYAAQQQKLACALQQHGIAISPGDGLNAWLPLETHSQATAFALAKSGWLVREGEAFGVS
FT                   TSSHGLRITLSTLNDSEINMLAADIHQALNR"
     MINGKTASEI FNSIRQHITA GTLRAEDSLP PVRELASELK VNRNTVAAAY KRLITAGLAQ        60
     SLGRNGTVIK GSPSPVALEG GDPHTPLRDL SGGNPDPQRL PDLSRYFARL SRTPHLYGDA       120
     PVSPELHAWA VRWLQDAMPV AGEIDITSGA IDAIERLLCA HLLPGDSVAV EDPCFLSSIN       180
     MLRYAGFSAS PVSVDSEGMQ PEKLEQALSQ GARAVILTPR AHNPTGCSLS ALRAAALQNI       240
     LARYPQILVI IDDHFALLSS SPWQPVIAQA TQHWAVIRSV SKTLGPDLRL AIIASDSATS       300
     AKLRLRLNAG SQWVSHLLQD LVCACLTDPE YQHRLTQTRL FYAAQQQKLA CALQQHGIAI       360
     SPGDGLNAWL PLETHSQATA FALAKSGWLV REGEAFGVST SSHGLRITLS TLNDSEINML       420
     AADIHQALNR                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page