(data stored in SCRATCH zone)

EMBL: CP000880.PE437

CP000880.PE437       Location/Qualifiers
FT   CDS             complement(458439..460166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2432 1.5e-295 ptsI; General PTS family
FT                   (Enzyme I) PEP-protein phosphotransferase K08483; COG:
FT                   COG1080 Phosphoenolpyruvate-protein kinase (PTS system EI
FT                   component in bacteria); Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20391"
FT                   /db_xref="GOA:A9MIF4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIF4"
FT                   /inference="protein motif:BlastProDom:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR008279"
FT                   /inference="protein motif:HMMPfam:IPR008731"
FT                   /inference="protein motif:HMMTigr:IPR006318"
FT                   /inference="protein motif:ScanRegExp:IPR000121"
FT                   /inference="protein motif:ScanRegExp:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008731"
FT                   /inference="similar to AA sequence:INSD:AAO68143.1"
FT                   /protein_id="ABX20391.1"
FT                   /translation="MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFLS
FT                   GRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAA
FT                   HEVIEGQATALEELDDEYLKERAADVRDIGKRLLRNILGLAIIDLSAIQEEVILVAADL
FT                   TPSETAQLNLQKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNGDFIILDA
FT                   VNNQVYVNPTNDVIEQLRAVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDV
FT                   EGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDK
FT                   ELPYMNFPKEENPFLGWRAVRIAMDRKEILRDQVRAILRASAFGKLRIMFPMIISVEEV
FT                   RALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC"
     MISGILASPG IAFGKALLLK EDEIVIDRKK ISADKVDQEV ERFLSGRAKA SAQLEAIKTK        60
     AGETFGEEKE AIFEGHIMLL EDEELEQEII ALIKDKHMTA DAAAHEVIEG QATALEELDD       120
     EYLKERAADV RDIGKRLLRN ILGLAIIDLS AIQEEVILVA ADLTPSETAQ LNLQKVLGFI       180
     TDAGGRTSHT SIMARSLELP AIVGTGSVTS QVKNGDFIIL DAVNNQVYVN PTNDVIEQLR       240
     AVQEQVASEK AELAKLKDLP AITLDGHQVE VCANIGTVRD VEGAERNGAE GVGLYRTEFL       300
     FMDRDALPTE EEQFAAYKAV AEACGSQAVI VRTMDIGGDK ELPYMNFPKE ENPFLGWRAV       360
     RIAMDRKEIL RDQVRAILRA SAFGKLRIMF PMIISVEEVR ALRKEIEIYK QELRDEGKAF       420
     DESIEIGVMV ETPAAATIAR HLAKEVDFFS IGTNDLTQYT LAVDRGNDMI SHLYQPMSPS       480
     VLNLIKQVID ASHAEGKWTG MCGELAGDER ATLLLLGMGL DEFSMSAISI PRIKKIIRNT       540
     NFEDAKVLAE QALAQPTTDE LMTLVNKFIE EKTIC                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page