(data stored in SCRATCH zone)

EMBL: CP000880.PE445

CP000880.PE445       Location/Qualifiers
FT   CDS             complement(466269..467267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00463"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0385 Predicted Na+-dependent transporter;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20399"
FT                   /db_xref="GOA:A9MIG2"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIG2"
FT                   /inference="protein motif:HMMPfam:IPR002657"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217410.1"
FT                   /protein_id="ABX20399.1"
FT                   /translation="MKLFRILDPFTLTLITVVLLASFFPAEGGFVPVVEGITTAAIALL
FT                   FFMHGAKLSRDAIIAGGSHWRLHLWVMCSTFVLFPVLGVLFAWWAPVNVDPMLYSGFLY
FT                   LCILPATVQSAIAFTSLAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNIHGAQGSLEE
FT                   VGRIMLQLLLPFVLGHLSRPWIGNWVARNKKWIAKTDQTSILLVVYSAFSEAVVNGIWH
FT                   KVGWGSLLFIVVVSLVLLAIVIAINVFVARKCGFNKADEITIVFCGSKKSLANGIPMAN
FT                   ILFPTSVLGMMVLPLMIFHQIQLMVCAELARRYKRQTEKLQAQQESCAAKA"
     MKLFRILDPF TLTLITVVLL ASFFPAEGGF VPVVEGITTA AIALLFFMHG AKLSRDAIIA        60
     GGSHWRLHLW VMCSTFVLFP VLGVLFAWWA PVNVDPMLYS GFLYLCILPA TVQSAIAFTS       120
     LAGGNVAAAV CSASASSLLG IFLSPLLVGL VMNIHGAQGS LEEVGRIMLQ LLLPFVLGHL       180
     SRPWIGNWVA RNKKWIAKTD QTSILLVVYS AFSEAVVNGI WHKVGWGSLL FIVVVSLVLL       240
     AIVIAINVFV ARKCGFNKAD EITIVFCGSK KSLANGIPMA NILFPTSVLG MMVLPLMIFH       300
     QIQLMVCAEL ARRYKRQTEK LQAQQESCAA KA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page