(data stored in SCRATCH zone)

EMBL: CP000880.PE460

CP000880.PE460       Location/Qualifiers
FT   CDS             485352..486395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2384 1.3e-161 ypdE; predicted peptidase
FT                   K01269; COG: COG1363 Cellulase M and related proteins;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20414"
FT                   /db_xref="GOA:A9MIH7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A9MIH7"
FT                   /inference="protein motif:HMMPfam:IPR008007"
FT                   /inference="similar to AA sequence:INSD:EAY49462.1"
FT                   /protein_id="ABX20414.1"
FT                   /translation="MMDLSLLKALCEADAIAASEQEVRQILLDEADRLHKEVRFDGLGS
FT                   VLIRLNASDGPKVMICAHMDEVGFMVRSISGEGAIDVLPVGNVRMAARQLQPVRITTRE
FT                   ECKIPGLLEGERSGNEVSGLRVDIGARSHDEVIQAGIRPGDRVTFDSAFQVLPHQRVMG
FT                   KAFDDRLGCYLLIALLREWHDAELPAEIWLAASSSEEVGLRGGQTAARAIAPDLAIVLD
FT                   TACWAKNFDYGAANHRQIGQGPMLVLSDKSLIAPPKLTAWIESIAAQAGIPLQLDMFSN
FT                   GGTDGGVVHLSGTGIPTVVLGPATRHGHCAASIADCRDILQTQQLLSALITGFTRDTVA
FT                   RLTDFRC"
     MMDLSLLKAL CEADAIAASE QEVRQILLDE ADRLHKEVRF DGLGSVLIRL NASDGPKVMI        60
     CAHMDEVGFM VRSISGEGAI DVLPVGNVRM AARQLQPVRI TTREECKIPG LLEGERSGNE       120
     VSGLRVDIGA RSHDEVIQAG IRPGDRVTFD SAFQVLPHQR VMGKAFDDRL GCYLLIALLR       180
     EWHDAELPAE IWLAASSSEE VGLRGGQTAA RAIAPDLAIV LDTACWAKNF DYGAANHRQI       240
     GQGPMLVLSD KSLIAPPKLT AWIESIAAQA GIPLQLDMFS NGGTDGGVVH LSGTGIPTVV       300
     LGPATRHGHC AASIADCRDI LQTQQLLSAL ITGFTRDTVA RLTDFRC                     347
//

If you have problems or comments...

PBIL Back to PBIL home page