(data stored in SCRATCH zone)

EMBL: CP000880.PE469

CP000880.PE469       Location/Qualifiers
FT   CDS             497232..498275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2396 1.6e-154 pgtE; phosphoglycerate
FT                   transport: outer membrane protein E K08477; COG: COG4571
FT                   Outer membrane protease; Psort location: OuterMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20423"
FT                   /db_xref="GOA:A9MII6"
FT                   /db_xref="InterPro:IPR000036"
FT                   /db_xref="InterPro:IPR020079"
FT                   /db_xref="InterPro:IPR020080"
FT                   /db_xref="UniProtKB/TrEMBL:A9MII6"
FT                   /inference="protein motif:BlastProDom:IPR000036"
FT                   /inference="protein motif:FPrintScan:IPR000036"
FT                   /inference="protein motif:HMMPfam:IPR000036"
FT                   /inference="protein motif:ScanRegExp:IPR000036"
FT                   /inference="protein motif:ScanRegExp:IPR002048"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217383.1"
FT                   /protein_id="ABX20423.1"
FT                   /translation="MRQVFWRNKCTLVRRFDKIKLHHLSRLYLNIRVREMKTHVIAVMI
FT                   IAVFSESVYAESTLFIPDFSPDSVTTSLSAGVLNGKSRELVYDIDTGRKLSQLDWKIKN
FT                   VAILQGDLSWDPYSFVTLNARGWTSLASGSGHLVDRDWMNSEQSGWTDRSIHPDTSVNH
FT                   ANEYDLNVKGWLLQGDNFKAGVTAGYQETRFSWTARGGSYSYDNGQYIGNFPPGKRVIG
FT                   YSQRFEMPYIGLAGHYRINDFEGNVMFKYSDWVHAHDNDEHYMRKLTFREKTGSSRYYG
FT                   ASVNAGYYITNNAKIFAEFAYSKYEEGKGGTQIIDKTSGDSEYFGGDVAGIANNNYTVT
FT                   AGLQYRF"
     MRQVFWRNKC TLVRRFDKIK LHHLSRLYLN IRVREMKTHV IAVMIIAVFS ESVYAESTLF        60
     IPDFSPDSVT TSLSAGVLNG KSRELVYDID TGRKLSQLDW KIKNVAILQG DLSWDPYSFV       120
     TLNARGWTSL ASGSGHLVDR DWMNSEQSGW TDRSIHPDTS VNHANEYDLN VKGWLLQGDN       180
     FKAGVTAGYQ ETRFSWTARG GSYSYDNGQY IGNFPPGKRV IGYSQRFEMP YIGLAGHYRI       240
     NDFEGNVMFK YSDWVHAHDN DEHYMRKLTF REKTGSSRYY GASVNAGYYI TNNAKIFAEF       300
     AYSKYEEGKG GTQIIDKTSG DSEYFGGDVA GIANNNYTVT AGLQYRF                     347
//

If you have problems or comments...

PBIL Back to PBIL home page