(data stored in SCRATCH zone)

EMBL: CP000880.PE489

CP000880.PE489       Location/Qualifiers
FT   CDS             516492..517316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0481 2.2e-150 mepA;
FT                   penicillin-insensitive murein endopeptidase precursor
FT                   K07261; COG: COG3770 Murein endopeptidase; Psort location:
FT                   Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20443"
FT                   /db_xref="GOA:A9MJ43"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ43"
FT                   /inference="protein motif:BlastProDom:IPR005073"
FT                   /inference="protein motif:HMMPfam:IPR005073"
FT                   /inference="protein motif:HMMPIR:IPR005073"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456924.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20443.1"
FT                   /translation="MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSVGSFANGCI
FT                   IGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAHQRGLGTVLIGDMGMPAGG
FT                   RFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASL
FT                   IKLAAEDNDVTRIFVNPAIKQQLCLDAGSDRDWLRKVRPWFQHRAHMHVRLRCPADSLE
FT                   CEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVL"
     MKKTAIALLA WFVSSASLAA TPWQKITHPV PGAAQSVGSF ANGCIIGADT LPVQSDNYQV        60
     MRTDQRRYFG HPDLVMFIQR LSHQAHQRGL GTVLIGDMGM PAGGRFNGGH ASHQTGLDVD       120
     IFLQLPKTRW SQAQLLRPQA LDLVSRDGKH VVPSRWSSDI ASLIKLAAED NDVTRIFVNP       180
     AIKQQLCLDA GSDRDWLRKV RPWFQHRAHM HVRLRCPADS LECEDQPLPP PGDGCGAELQ       240
     SWFEPPKPGT TKPEKKTPPP LPPSCQALLD EHVL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page