(data stored in SCRATCH zone)

EMBL: CP000880.PE494

CP000880.PE494       Location/Qualifiers
FT   CDS             521189..522409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0486 8.9e-211 fabB;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase I K00647; COG:
FT                   COG0304 3-oxoacyl-(acyl-carrier-protein) synthase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20448"
FT                   /db_xref="GOA:A9MJ48"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ48"
FT                   /inference="protein motif:HMMPanther:IPR000794"
FT                   /inference="protein motif:HMMPfam:IPR000794"
FT                   /inference="protein motif:ScanRegExp:IPR000794"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149800.1"
FT                   /protein_id="ABX20448.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDAGMR
FT                   SQVWGNVKLDTTGLIDRKVVRFMSDASIYAYLSMEQAVADAGLAPEVYQNNPRVGLIAG
FT                   SGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIFGVNYSISSAC
FT                   ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTY
FT                   DAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM
FT                   QMAMHGVDTPIDYLNSHGTSTPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGV
FT                   QEAIYSLLMLEHGFIAPSINIEQMDEQAAGLNIVTETTERGLTTVMSNSFGFGGTNATL
FT                   VMRKLKG"
     MKRAVITGLG IVSSIGNNQQ EVLASLREGR SGITFSQELK DAGMRSQVWG NVKLDTTGLI        60
     DRKVVRFMSD ASIYAYLSME QAVADAGLAP EVYQNNPRVG LIAGSGGGSP KFQVFGADAM       120
     RSPRGLKAVG PYVVTKAMAS GVSACLATPF KIFGVNYSIS SACATSAHCI GNAVEQIQLG       180
     KQDIVFAGGG EELCWEMACE FDAMGALSTK YNDTPEKASR TYDAHRDGFV IAGGGGMVVV       240
     EELEHALARG AHIYAEIVGY GATSDGADMV APSGEGAVRC MQMAMHGVDT PIDYLNSHGT       300
     STPVGDVKEL GAIREVFGDK SPAISATKAM TGHSLGAAGV QEAIYSLLML EHGFIAPSIN       360
     IEQMDEQAAG LNIVTETTER GLTTVMSNSF GFGGTNATLV MRKLKG                      406
//

If you have problems or comments...

PBIL Back to PBIL home page