(data stored in SCRATCH zone)

EMBL: CP000880.PE499

CP000880.PE499       Location/Qualifiers
FT   CDS             524604..525782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll2324 0.00030
FT                   long-chain-fatty-acid--[acyl-carrier-protein] ligase /
FT                   acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase
FT                   K05939:K01909; COG: COG0477 Permeases of the major
FT                   facilitator superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20453"
FT                   /db_xref="GOA:A9MJ53"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037541"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MJ53"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149806.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX20453.1"
FT                   /translation="MTAVSQKTHTPPANFLLFRIAFAVFLTYMTVGLPLPVIPLFVRHE
FT                   LGYSNTMVGIAVGIQFFATVLTRGYAGRLADQYGAKRSALQGMLACGLAGAAWLLAALL
FT                   PVSASVKFALLIVGRLILGFGESQLLTGTLTWGMGLVGPARSGKVMSWNGMAIYGALAA
FT                   GAPLGLLIHSHFGFAALAVTTMALPLLAWAFNGTVRKVPAHAGERPSLWSVVGLIWKPG
FT                   LGLALQGVGFAVIGTFISLYFASNGWAMAGFTLTAFGGAFVLMRMLFGWMPDRFGGVKV
FT                   AIVSLLVETAGLLLLWLAPMAWIALVGAALTGAGCSLIFPALGVEVVKRVPSQVRGTAL
FT                   GGYAAFQDISYGVTGPLAGVLATSCGYSSVFLAGALSAVVGILVTILSFRRG"
     MTAVSQKTHT PPANFLLFRI AFAVFLTYMT VGLPLPVIPL FVRHELGYSN TMVGIAVGIQ        60
     FFATVLTRGY AGRLADQYGA KRSALQGMLA CGLAGAAWLL AALLPVSASV KFALLIVGRL       120
     ILGFGESQLL TGTLTWGMGL VGPARSGKVM SWNGMAIYGA LAAGAPLGLL IHSHFGFAAL       180
     AVTTMALPLL AWAFNGTVRK VPAHAGERPS LWSVVGLIWK PGLGLALQGV GFAVIGTFIS       240
     LYFASNGWAM AGFTLTAFGG AFVLMRMLFG WMPDRFGGVK VAIVSLLVET AGLLLLWLAP       300
     MAWIALVGAA LTGAGCSLIF PALGVEVVKR VPSQVRGTAL GGYAAFQDIS YGVTGPLAGV       360
     LATSCGYSSV FLAGALSAVV GILVTILSFR RG                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page