(data stored in SCRATCH zone)

EMBL: CP000880.PE509

CP000880.PE509       Location/Qualifiers
FT   CDS             534388..535905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0502 2.5e-270 purF;
FT                   amidophosphoribosyltransferase K00764; COG: COG0034
FT                   Glutamine phosphoribosylpyrophosphate amidotransferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20463"
FT                   /db_xref="GOA:A9MJ63"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ63"
FT                   /inference="protein motif:HMMPanther:IPR005854"
FT                   /inference="protein motif:HMMPfam:IPR000583"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005854"
FT                   /inference="protein motif:ScanRegExp:IPR000583"
FT                   /inference="protein motif:ScanRegExp:IPR002375"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149816.1"
FT                   /protein_id="ABX20463.1"
FT                   /translation="MCGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRL
FT                   RKANGLVNDIFEARHMQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGN
FT                   LTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDNFRHYPLEADNIFAAIAATNRQ
FT                   IRGAYACVAMIIGHGMVAFRDPHGIRPLVLGKRDVGDGRTEYMVASESVALDTLGFEFL
FT                   RDVAPGEAIYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGT
FT                   KLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQ
FT                   QLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPE
FT                   IRFPNVYGIDMPTANELIAHGREVDEIRQIIGADGLIFQDLDDLIEAVRAENPDIQQFE
FT                   CSVFNGVYVTKDVDQQYLDFLDSLRNDDAKAVLFQNEMENLEMHNEG"
     MCGIVGIAGV MPVNQSIYDA LTVLQHRGQD AAGIITIDAN NCFRLRKANG LVNDIFEARH        60
     MQRLQGNMGI GHVRYPTAGS SSASEAQPFY VNSPYGITLA HNGNLTNAHE LRKKLFEEKR       120
     RHINTTSDSE ILLNIFASEL DNFRHYPLEA DNIFAAIAAT NRQIRGAYAC VAMIIGHGMV       180
     AFRDPHGIRP LVLGKRDVGD GRTEYMVASE SVALDTLGFE FLRDVAPGEA IYITEKGQLF       240
     TRQCADNPVS NPCLFEYVYF ARPDSFIDKI SVYSARVNMG TKLGEKIARE WEDLDIDVVI       300
     PIPETSCDIA LEIARILGKP YRQGFVKNRY VGRTFIMPGQ QLRRKSVRRK LNANRAEFRD       360
     KNVLLVDDSI VRGTTSEQII EMAREAGAKK VYLASAAPEI RFPNVYGIDM PTANELIAHG       420
     REVDEIRQII GADGLIFQDL DDLIEAVRAE NPDIQQFECS VFNGVYVTKD VDQQYLDFLD       480
     SLRNDDAKAV LFQNEMENLE MHNEG                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page