(data stored in SCRATCH zone)

EMBL: CP000880.PE514

CP000880.PE514       Location/Qualifiers
FT   CDS             541633..542961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 2.6e-53 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG0833 Amino acid
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20468"
FT                   /db_xref="GOA:A9MJ68"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A9MJ68"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149821.1"
FT                   /protein_id="ABX20468.1"
FT                   /translation="MMSLGGTIGTGLFIGIAEPLSSVGPARALLAYLFAGAIMLATMMC
FT                   LGELSCAFPHSGSFQHYALMFMPSPVWSYTIGWLYWFSWGFSLAADLTAAGFIAHQFFP
FT                   AVPVYIFCLAILLILTVINFTSAKSFGECEYWLSAIKVFAIVLFICAGGVMIYSLMGHS
FT                   DWHPTLKTNGMWFPHGWEQIVVCMTIVIYSFQGGELVGNAAGETESPHAILPKVILGIG
FT                   LRIILFYGLAIAVLALVYPHKLAPNGQSPFVWVFSHAGIPGADTLMTLVIFSAAVSAAN
FT                   SAIYASSRMLWSMAGDRFAPACFGKTNGGGVPVYAILITVLLALVSLLTRYIPAQQFYL
FT                   YLIASTGQVGCLAWITIGWCQYRFRQSVCNGTYASDLLRYRSPLFPWTARFVIITNFAI
FT                   MVGTWFSEQGGVIMLVELAFMTGILLSWYLFRPTLSRLRNTVG"
     MMSLGGTIGT GLFIGIAEPL SSVGPARALL AYLFAGAIML ATMMCLGELS CAFPHSGSFQ        60
     HYALMFMPSP VWSYTIGWLY WFSWGFSLAA DLTAAGFIAH QFFPAVPVYI FCLAILLILT       120
     VINFTSAKSF GECEYWLSAI KVFAIVLFIC AGGVMIYSLM GHSDWHPTLK TNGMWFPHGW       180
     EQIVVCMTIV IYSFQGGELV GNAAGETESP HAILPKVILG IGLRIILFYG LAIAVLALVY       240
     PHKLAPNGQS PFVWVFSHAG IPGADTLMTL VIFSAAVSAA NSAIYASSRM LWSMAGDRFA       300
     PACFGKTNGG GVPVYAILIT VLLALVSLLT RYIPAQQFYL YLIASTGQVG CLAWITIGWC       360
     QYRFRQSVCN GTYASDLLRY RSPLFPWTAR FVIITNFAIM VGTWFSEQGG VIMLVELAFM       420
     TGILLSWYLF RPTLSRLRNT VG                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page