(data stored in SCRATCH zone)

EMBL: CP000880.PE57

CP000880.PE57        Location/Qualifiers
FT   CDS             complement(59668..60087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00058"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20011"
FT                   /db_xref="GOA:A9MF59"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF59"
FT                   /protein_id="ABX20011.1"
FT                   /translation="MTNMDSKKLKRCAQIILFFYGASFLLTFLIGISNLIPPYIYIIFF
FT                   TPFFVAYCGFSIYLGRKKVFKSLNDSILFSFAPIAMFKPVKILLFKAENINETISNSDK
FT                   ILMCLYLLIAVCSIIKALISLNELYDNLKKPEKNS"
     MTNMDSKKLK RCAQIILFFY GASFLLTFLI GISNLIPPYI YIIFFTPFFV AYCGFSIYLG        60
     RKKVFKSLND SILFSFAPIA MFKPVKILLF KAENINETIS NSDKILMCLY LLIAVCSIIK       120
     ALISLNELYD NLKKPEKNS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page