(data stored in SCRATCH zone)

EMBL: CP000880.PE67

CP000880.PE67        Location/Qualifiers
FT   CDS             67567..68139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00068"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3328 Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20021"
FT                   /db_xref="GOA:A9MF69"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF69"
FT                   /inference="protein motif:HMMPfam:IPR001207"
FT                   /inference="similar to AA sequence:REFSEQ:NP_783715.1"
FT                   /protein_id="ABX20021.1"
FT                   /translation="MSQPFDFDKALKALQSGQALTGKDGILTPLIKPLTEAALAAELDS
FT                   HLASDVEANRKNGSGKKTIKAATGSFELATPRDRNGTFEPQLVKKHQTTLSDEIVHKII
FT                   RLFALGMSCQDISREIEDLYALSVSTATISAVTDKVIPELKQWQQRPLEKVYPFVRLDA
FT                   IHYKVREDGAIRCGSFYHDAMGKAVAG"
     MSQPFDFDKA LKALQSGQAL TGKDGILTPL IKPLTEAALA AELDSHLASD VEANRKNGSG        60
     KKTIKAATGS FELATPRDRN GTFEPQLVKK HQTTLSDEIV HKIIRLFALG MSCQDISREI       120
     EDLYALSVST ATISAVTDKV IPELKQWQQR PLEKVYPFVR LDAIHYKVRE DGAIRCGSFY       180
     HDAMGKAVAG                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page