(data stored in SCRATCH zone)

EMBL: CP000880.PE76

CP000880.PE76        Location/Qualifiers
FT   CDS             74594..76591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00077"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4789 Type III secretory pathway, component
FT                   EscV; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20030"
FT                   /db_xref="GOA:A9MF78"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF78"
FT                   /inference="protein motif:HMMPfam:IPR001712"
FT                   /inference="protein motif:HMMTigr:IPR006302"
FT                   /inference="protein motif:ScanRegExp:IPR001712"
FT                   /protein_id="ABX20030.1"
FT                   /translation="MVMIISMFVIPLPTYLVDFLIALNIVLAILVFMGSFYIDRILSFS
FT                   TFPAVLLITTLFRLALSISTSRLILIEADAGEIIATFGQFVIGDSLAVGFVVFSIVTVV
FT                   QFIVITKGSERVAEVAARFSLDGMPGKQMSIDADLKAGIIDADAARERRSVLERESQLY
FT                   GSFDGAMKFIKGDAIAGIIIIFVNFIGGISVGMTRHGMDLSSALSTYTMLTIGDGLVAQ
FT                   IPALLIAISAGFIVTRVNGDSDNMGRNIMTQLLNNPFVLVVTAILTISMGTLPGFPLPV
FT                   FVILSVVLSVLFYFKFREAKRSAGTPKTSKGEQPLSIEEKEGTSLGLIGDLDKVSTETV
FT                   PLILLVPKSRREDLEKAQLADRLRSQFFIDYGVRLPEVLLRDGEGLDDNSIVLLINEIR
FT                   VEQFTVYFDLMRVVNYSDEVVSFGINPTTHQQGSSQYFWVTHEEGEKLRELGYVLRNAL
FT                   DELYHCLAVTLARNVNEYFGIQETKHMLDQLEAKFPDLLKEVLRHATVQRISEVLQRLL
FT                   SERVSVRNMKLIMEALALWAPREKDVINLVEHIRGAMARYICHKFANGGELRAVMVSAE
FT                   VEDVIRKGIRQTSGSTFLSLEPEASANLMDLITLKLDDLLIAHKDLVLLTSVDVRRFIK
FT                   KMIEGRFPDLEVLSFGEIADSKSVNVIKTI"
     MVMIISMFVI PLPTYLVDFL IALNIVLAIL VFMGSFYIDR ILSFSTFPAV LLITTLFRLA        60
     LSISTSRLIL IEADAGEIIA TFGQFVIGDS LAVGFVVFSI VTVVQFIVIT KGSERVAEVA       120
     ARFSLDGMPG KQMSIDADLK AGIIDADAAR ERRSVLERES QLYGSFDGAM KFIKGDAIAG       180
     IIIIFVNFIG GISVGMTRHG MDLSSALSTY TMLTIGDGLV AQIPALLIAI SAGFIVTRVN       240
     GDSDNMGRNI MTQLLNNPFV LVVTAILTIS MGTLPGFPLP VFVILSVVLS VLFYFKFREA       300
     KRSAGTPKTS KGEQPLSIEE KEGTSLGLIG DLDKVSTETV PLILLVPKSR REDLEKAQLA       360
     DRLRSQFFID YGVRLPEVLL RDGEGLDDNS IVLLINEIRV EQFTVYFDLM RVVNYSDEVV       420
     SFGINPTTHQ QGSSQYFWVT HEEGEKLREL GYVLRNALDE LYHCLAVTLA RNVNEYFGIQ       480
     ETKHMLDQLE AKFPDLLKEV LRHATVQRIS EVLQRLLSER VSVRNMKLIM EALALWAPRE       540
     KDVINLVEHI RGAMARYICH KFANGGELRA VMVSAEVEDV IRKGIRQTSG STFLSLEPEA       600
     SANLMDLITL KLDDLLIAHK DLVLLTSVDV RRFIKKMIEG RFPDLEVLSF GEIADSKSVN       660
     VIKTI                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page