(data stored in SCRATCH zone)

EMBL: CP000880.PE79

CP000880.PE79        Location/Qualifiers
FT   CDS             78391..78735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bta:282041 0.0055 ROCK2; Rho-associated,
FT                   coiled-coil containing protein kinase 2 K04514; COG:
FT                   NOG18535 non supervised orthologous group; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20033"
FT                   /db_xref="InterPro:IPR002954"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF81"
FT                   /inference="protein motif:HMMPfam:IPR002954"
FT                   /inference="similar to AA sequence:INSD:AAC45013.1"
FT                   /protein_id="ABX20033.1"
FT                   /translation="MLHAEEEAIVEQIAGLKLLLDTLRAENRQLSREEIYSLLRRQSIV
FT                   RRQIRDLQLQITQIQEKRCELEKKTQEFQEKSKYWLRKEGNYQRWIVRQKRFYIQREIQ
FT                   QEEAESEEII"
     MLHAEEEAIV EQIAGLKLLL DTLRAENRQL SREEIYSLLR RQSIVRRQIR DLQLQITQIQ        60
     EKRCELEKKT QEFQEKSKYW LRKEGNYQRW IVRQKRFYIQ REIQQEEAES EEII             114
//

If you have problems or comments...

PBIL Back to PBIL home page