(data stored in SCRATCH zone)

EMBL: CP000880.PE89

CP000880.PE89        Location/Qualifiers
FT   CDS             87204..88226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00090"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06173 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABX20043"
FT                   /db_xref="GOA:A9MF91"
FT                   /db_xref="InterPro:IPR009483"
FT                   /db_xref="InterPro:IPR036708"
FT                   /db_xref="UniProtKB/TrEMBL:A9MF91"
FT                   /inference="protein motif:HMMPfam:IPR009483"
FT                   /inference="protein motif:HMMTigr:IPR013386"
FT                   /inference="similar to AA sequence:INSD:CAD05990.1"
FT                   /protein_id="ABX20043.1"
FT                   /translation="MLNIQNYSASPRPGLVAERPQTTSASEHVEITAAPATTEHRGADI
FT                   ITLSQAATKAQQAQQTLRSTLPVSEENNDERTLARQQLTSSLHALTKSGVSLSAEQNEG
FT                   LRSAFSAPAVALFSTAPMAQPRVTISDAEIWDMVSQNISAIGDNYLGVYENVVAVYTDF
FT                   YQAFSDILSKMGTWLAPGKDGNTVKLNVDALKSEIRSLVNKYNQVTKNTILFPSQTGSG
FT                   VTTATKAEAEQWIKELNLPGSCLKASGSGYVVLVDTGPLNKMVSDLNGIGSGSALELDN
FT                   AKYQAWQAGFKAQEENLKTTLQTLTQKYSNANSLYDNLVKVLSSTISSSLETAKSFLQG"
     MLNIQNYSAS PRPGLVAERP QTTSASEHVE ITAAPATTEH RGADIITLSQ AATKAQQAQQ        60
     TLRSTLPVSE ENNDERTLAR QQLTSSLHAL TKSGVSLSAE QNEGLRSAFS APAVALFSTA       120
     PMAQPRVTIS DAEIWDMVSQ NISAIGDNYL GVYENVVAVY TDFYQAFSDI LSKMGTWLAP       180
     GKDGNTVKLN VDALKSEIRS LVNKYNQVTK NTILFPSQTG SGVTTATKAE AEQWIKELNL       240
     PGSCLKASGS GYVVLVDTGP LNKMVSDLNG IGSGSALELD NAKYQAWQAG FKAQEENLKT       300
     TLQTLTQKYS NANSLYDNLV KVLSSTISSS LETAKSFLQG                             340
//

If you have problems or comments...

PBIL Back to PBIL home page