(data stored in SCRATCH zone)

EMBL: CP000880.PE9

CP000880.PE9         Location/Qualifiers
FT   CDS             14218..15516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SARI_00009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t2853 4.4e-225 eno; enolase K01689; COG:
FT                   COG0148 Enolase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:SARI_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABX19963"
FT                   /db_xref="GOA:A9MF11"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A9MF11"
FT                   /inference="protein motif:BlastProDom:IPR000941"
FT                   /inference="protein motif:FPrintScan:IPR000941"
FT                   /inference="protein motif:HMMPanther:IPR000941"
FT                   /inference="protein motif:HMMPfam:IPR000941"
FT                   /inference="protein motif:HMMTigr:IPR000941"
FT                   /inference="protein motif:ScanRegExp:IPR000941"
FT                   /inference="similar to AA sequence:INSD:AAX66792.1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="ABX19963.1"
FT                   /translation="MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVTKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKS
FT                   NFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKGKGMNTAVGDEGGYAPNLGSNAEA
FT                   LAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELT
FT                   KQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSIL
FT                   IKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSR
FT                   SDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA"
     MSKIVKVIGR EIIDSRGNPT VEAEVHLEGG FVGMAAAPSG ASTGSREALE LRDGDKSRFL        60
     GKGVTKAVGA VNGPIAQAIL GKDAKDQAGI DKIMIDLDGT ENKSNFGANA ILAVSLANAK       120
     AAAAAKGMPL YEHIAELNGT PGKYSMPVPM MNIINGGEHA DNNVDIQEFM IQPVGAKTVK       180
     EAIRMGSEVF HHLAKVLKGK GMNTAVGDEG GYAPNLGSNA EALAVIAEAV KAAGYELGKD       240
     ITLAMDCAAS EFYKDGKYVL AGEGNKAFTS EEFTHFLEEL TKQYPIVSIE DGLDESDWDG       300
     FAYQTKVLGD KIQLVGDDLF VTNTKILKEG IEKGIANSIL IKFNQIGSLT ETLAAIKMAK       360
     DAGYTAVISH RSGETEDATI ADLAVGTAAG QIKTGSMSRS DRVAKYNQLI RIEEALGEKA       420
     PYNGRKEIKG QA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page