(data stored in SCRATCH zone)

EMBL: CP000885.PE110

CP000885.PE110       Location/Qualifiers
FT   CDS             149444..152983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0112"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: tte:TTE2565 Transcription-repair coupling
FT                   factor - superfamily II helicase; TIGRFAM:
FT                   transcription-repair coupling factor; PFAM: helicase domain
FT                   protein; transcription factor CarD; TRCF domain protein;
FT                   type III restriction protein res subunit; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40501"
FT                   /db_xref="GOA:A9KR33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR33"
FT                   /protein_id="ABX40501.1"
FT                   /translation="MKTFTAPLQEYREFQVIEQSIQKNQFPLLITGCIDSQKCHLIHAL
FT                   SEGIVCKLVITYNDIKAKEIYEDLKLYDRNVYLYPAKDIIFYSADIHGNAIVRERMRIL
FT                   KNLLERKPMTVVATIDGGMDKLLPLDYLSDKIICIKEDSTIEIECLSEKLIHLGYERQG
FT                   QVENPGEFAIRGGIIDIYPLTEEAPYRIELWGDEVDSIRTFDVGSQRSIERVSTAVIYP
FT                   ASEIILEPEALKNGLHKLNIEQKEYVGKLRGELKTEEAARIHQIVEEFKENLECLQGSL
FT                   NLDSYIRFFYDKTCSFFDYFANDSSIIFADEPNRLAEKGEAVFTEFSESMVGRIEKGYI
FT                   LPSQMDVIYDYKELLANLSRRNSVLISTMDHKVMQLAAKKKVDITVKSVNPYNNNFEIL
FT                   IKDLQNWKRNGYRVILLSGSRTRAARLAQDLRDNELPAIYSEDVDRIPVKGEIVVMHGS
FT                   VHRGFEYPLIKLVIISESDIFGAEKKKKKKKPSYEGKQIQSFTDLNIGDYVVHENHGLG
FT                   IYRGIEKIEVDKVSKDYIKLEYGGGGVLYILATGLDVIQKYAGADARKPKLNKLNSVEW
FT                   KNTKAKVKGAVKEIAKELVELYATRQAKAGHSFCEDTVWQREFEEMFPYEETDDQLRAI
FT                   DDTKRDMESKKIMDRLICGDVGYGKTEIAIRAAFKAISDGKQVVFLVPTTILAQQHYNT
FT                   FSQRMMNFPISVDMLCRFKTPAQQKKTLENLKKGQLDILIGTHRVLSKDIQFKNLGLLI
FT                   IDEEQRFGVTHKEKIKQMKGDIDVLTLTATPIPRTLHMSLVGIRDMSVLEEPPVDRLPI
FT                   QTFVLEHNDEIIREAINRELARGGQVYYVHNRVNGLDEITNTIARLVPDANVAFAHGQM
FT                   HEHQLEKIMFEFINGEIDVLVSTTIIETGLDISNVNTMIIDNADQLGLSQLYQLRGRVG
FT                   RSNRTSFAFLMYKRDKLLKEVAEKRLQAIKEFTELGSGFKIAMRDLEIRGAGNLLGAQQ
FT                   SGHMEAVGYDLYCKMLNDAVKGLKGEISDEDTFDTSIDMDMDAFIPSTYIKNEMQKLDM
FT                   YKRIAGIENEEEFMDMQEEMLDRFGDIPTSVNNLLNIALLKSMAHQVYVSNLVQKGTEV
FT                   KLSMYPKAKIKVEMIPELLLKVGNNLKMIPGATPFFTYHMANVIKNPKVGTIDTLAVFE
FT                   SVKNLLLEFQILV"
     MKTFTAPLQE YREFQVIEQS IQKNQFPLLI TGCIDSQKCH LIHALSEGIV CKLVITYNDI        60
     KAKEIYEDLK LYDRNVYLYP AKDIIFYSAD IHGNAIVRER MRILKNLLER KPMTVVATID       120
     GGMDKLLPLD YLSDKIICIK EDSTIEIECL SEKLIHLGYE RQGQVENPGE FAIRGGIIDI       180
     YPLTEEAPYR IELWGDEVDS IRTFDVGSQR SIERVSTAVI YPASEIILEP EALKNGLHKL       240
     NIEQKEYVGK LRGELKTEEA ARIHQIVEEF KENLECLQGS LNLDSYIRFF YDKTCSFFDY       300
     FANDSSIIFA DEPNRLAEKG EAVFTEFSES MVGRIEKGYI LPSQMDVIYD YKELLANLSR       360
     RNSVLISTMD HKVMQLAAKK KVDITVKSVN PYNNNFEILI KDLQNWKRNG YRVILLSGSR       420
     TRAARLAQDL RDNELPAIYS EDVDRIPVKG EIVVMHGSVH RGFEYPLIKL VIISESDIFG       480
     AEKKKKKKKP SYEGKQIQSF TDLNIGDYVV HENHGLGIYR GIEKIEVDKV SKDYIKLEYG       540
     GGGVLYILAT GLDVIQKYAG ADARKPKLNK LNSVEWKNTK AKVKGAVKEI AKELVELYAT       600
     RQAKAGHSFC EDTVWQREFE EMFPYEETDD QLRAIDDTKR DMESKKIMDR LICGDVGYGK       660
     TEIAIRAAFK AISDGKQVVF LVPTTILAQQ HYNTFSQRMM NFPISVDMLC RFKTPAQQKK       720
     TLENLKKGQL DILIGTHRVL SKDIQFKNLG LLIIDEEQRF GVTHKEKIKQ MKGDIDVLTL       780
     TATPIPRTLH MSLVGIRDMS VLEEPPVDRL PIQTFVLEHN DEIIREAINR ELARGGQVYY       840
     VHNRVNGLDE ITNTIARLVP DANVAFAHGQ MHEHQLEKIM FEFINGEIDV LVSTTIIETG       900
     LDISNVNTMI IDNADQLGLS QLYQLRGRVG RSNRTSFAFL MYKRDKLLKE VAEKRLQAIK       960
     EFTELGSGFK IAMRDLEIRG AGNLLGAQQS GHMEAVGYDL YCKMLNDAVK GLKGEISDED      1020
     TFDTSIDMDM DAFIPSTYIK NEMQKLDMYK RIAGIENEEE FMDMQEEMLD RFGDIPTSVN      1080
     NLLNIALLKS MAHQVYVSNL VQKGTEVKLS MYPKAKIKVE MIPELLLKVG NNLKMIPGAT      1140
     PFFTYHMANV IKNPKVGTID TLAVFESVKN LLLEFQILV                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page