(data stored in SCRATCH zone)

EMBL: CP000885.PE117

CP000885.PE117       Location/Qualifiers
FT   CDS             159135..160706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0119"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; Substrate-binding region of
FT                   ABC-type glycine betaine transport system; KEGG:
FT                   cbe:Cbei_2870 substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40508"
FT                   /db_xref="GOA:A9KR40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A9KR40"
FT                   /protein_id="ABX40508.1"
FT                   /translation="MNFIEYITNNYEQILRLLLEHIKLTAISVGFAILIGVPLGILISY
FT                   AKRVSKPILMVANIIQAIPSMALLGFMIPFLGIGMVPAIVAVILYSLLPIIKNTYTGID
FT                   NINPQTLEAAKGIGLTPFQVLTKVQIPLALPVIMAGVRIASVTAVGLMTMAAFIGAGGL
FT                   GHLVFSGIRTVNNNQILAGAIPACLLALLVDFLLGLVEQLVAPISLQKGENNVKKKKRG
FT                   IQKGILAGAVFAIIAIFVFTAKGTNANNQKVITIGSKDFTEQAILGNLVADLIEGNTDI
FT                   KVNRKLDLGGTQVCFSALNKGEIDMYVEYSGTAYLSALGHTEKKDKDQVFDIVKDEFKS
FT                   KYNIDVLKQMNFNNTYALAVTKEAAAKYQLKNISDLAKIAQTMKSGTTFEFLNREDGLP
FT                   GLQKEYGFTIGETVAIDGAPRYTALVNKDVDIIDAFTTDGLLKKFGLAVLEDDKAFFPP
FT                   YYAMPIVRSESLEQHPEIIPLLEELGDVLTNDIMLELNYQVDELQKSPEAVAKEFLKNQ
FT                   NLIPSK"
     MNFIEYITNN YEQILRLLLE HIKLTAISVG FAILIGVPLG ILISYAKRVS KPILMVANII        60
     QAIPSMALLG FMIPFLGIGM VPAIVAVILY SLLPIIKNTY TGIDNINPQT LEAAKGIGLT       120
     PFQVLTKVQI PLALPVIMAG VRIASVTAVG LMTMAAFIGA GGLGHLVFSG IRTVNNNQIL       180
     AGAIPACLLA LLVDFLLGLV EQLVAPISLQ KGENNVKKKK RGIQKGILAG AVFAIIAIFV       240
     FTAKGTNANN QKVITIGSKD FTEQAILGNL VADLIEGNTD IKVNRKLDLG GTQVCFSALN       300
     KGEIDMYVEY SGTAYLSALG HTEKKDKDQV FDIVKDEFKS KYNIDVLKQM NFNNTYALAV       360
     TKEAAAKYQL KNISDLAKIA QTMKSGTTFE FLNREDGLPG LQKEYGFTIG ETVAIDGAPR       420
     YTALVNKDVD IIDAFTTDGL LKKFGLAVLE DDKAFFPPYY AMPIVRSESL EQHPEIIPLL       480
     EELGDVLTND IMLELNYQVD ELQKSPEAVA KEFLKNQNLI PSK                         523
//

If you have problems or comments...

PBIL Back to PBIL home page