(data stored in SCRATCH zone)

EMBL: CP000885.PE12

CP000885.PE12        Location/Qualifiers
FT   CDS             22337..23074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cphy_0012"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: cno:NT01CX_0771 transcriptional regulator, Sir2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Cphy_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABX40403"
FT                   /db_xref="GOA:A9KPQ2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A9KPQ2"
FT                   /protein_id="ABX40403.1"
FT                   /translation="MTKETEQLIEIVKESNNIVFFGGAGVSTESGIPDFRSENGLYTTG
FT                   QGKKYSPEQLLSHSFFMRHTHDFFAYYKSHMIYKEAKPNPAHLALAKLEELGKLSAVIT
FT                   QNIDSLHQVAGSQTVYELHGSSNRNYCMKCRKSFSLDQIMKMDTVPICTNCGGVVKPDV
FT                   VLYEEELKQATIQKAIDAILKADTMIVGGTSLVVWPAASLIEYFQGKNLVLINKSETTY
FT                   DTMASLVIHDSIGEVLDSVIRTL"
     MTKETEQLIE IVKESNNIVF FGGAGVSTES GIPDFRSENG LYTTGQGKKY SPEQLLSHSF        60
     FMRHTHDFFA YYKSHMIYKE AKPNPAHLAL AKLEELGKLS AVITQNIDSL HQVAGSQTVY       120
     ELHGSSNRNY CMKCRKSFSL DQIMKMDTVP ICTNCGGVVK PDVVLYEEEL KQATIQKAID       180
     AILKADTMIV GGTSLVVWPA ASLIEYFQGK NLVLINKSET TYDTMASLVI HDSIGEVLDS       240
     VIRTL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page